Recombinant Human RABL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RABL3-4373H |
Product Overview : | RABL3 MS Standard C13 and N15-labeled recombinant protein (NP_776186) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RABL3 (RAB, Member Of RAS Oncogene Family Like 3) is a Protein Coding gene. Diseases associated with RABL3 include Pancreatic Cancer 5 and Pancreatic Cancer. Gene Ontology (GO) annotations related to this gene include GTP binding and GTPase activity. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RABL3 RAB, member of RAS oncogene family like 3 [ Homo sapiens (human) ] |
Official Symbol | RABL3 |
Synonyms | RABL3; RAB, member of RAS oncogene family like 3; PNCA5; rab-like protein 3 |
Gene ID | 285282 |
mRNA Refseq | NM_173825 |
Protein Refseq | NP_776186 |
MIM | 618542 |
UniProt ID | Q5HYI8 |
◆ Recombinant Proteins | ||
RABL3-2145H | Recombinant Human RABL3 protein, GST-tagged | +Inquiry |
RABL3-13854M | Recombinant Mouse RABL3 Protein | +Inquiry |
RABL3-7866H | Recombinant Human RABL3 protein, His-tagged | +Inquiry |
RABL3-7376M | Recombinant Mouse RABL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RABL3-2479C | Recombinant Chicken RABL3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABL3-2569HCL | Recombinant Human RABL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RABL3 Products
Required fields are marked with *
My Review for All RABL3 Products
Required fields are marked with *