Recombinant Human RABL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RABL3-4373H
Product Overview : RABL3 MS Standard C13 and N15-labeled recombinant protein (NP_776186) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RABL3 (RAB, Member Of RAS Oncogene Family Like 3) is a Protein Coding gene. Diseases associated with RABL3 include Pancreatic Cancer 5 and Pancreatic Cancer. Gene Ontology (GO) annotations related to this gene include GTP binding and GTPase activity.
Molecular Mass : 26.3 kDa
AA Sequence : MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RABL3 RAB, member of RAS oncogene family like 3 [ Homo sapiens (human) ]
Official Symbol RABL3
Synonyms RABL3; RAB, member of RAS oncogene family like 3; PNCA5; rab-like protein 3
Gene ID 285282
mRNA Refseq NM_173825
Protein Refseq NP_776186
MIM 618542
UniProt ID Q5HYI8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RABL3 Products

Required fields are marked with *

My Review for All RABL3 Products

Required fields are marked with *

0
cart-icon