Recombinant Human RABL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RABL3-4373H
• Product Overview: RABL3 MS Standard C13 and N15-labeled recombinant protein (NP_776186) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RABL3 (RAB, Member Of RAS Oncogene Family Like 3) is a Protein Coding gene. Diseases associated with RABL3 include Pancreatic Cancer 5 and Pancreatic Cancer. Gene Ontology (GO) annotations related to this gene include GTP binding and GTPase activity.
• Molecular Mass: 26.3 kDa
• AA Sequence: MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTCYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTTTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RABL3 RAB, member of RAS oncogene family like 3 [ Homo sapiens (human) ]
• Official Symbol: RABL3
• Synonyms: RABL3; RAB, member of RAS oncogene family like 3; PNCA5; rab-like protein 3
• Gene ID: 285282
• mRNA Refseq: NM_173825
• Protein Refseq: NP_776186
• MIM: 618542
• UniProt ID: Q5HYI8