Recombinant Human RAD51B protein, T7/His-tagged

• Cat.No.: RAD51B-121H
• Product Overview: Recombinant human RAD51B (383aa, Isoform-I, derived from BC030219) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag fusion at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 383 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYR GVHELLCMVSRACAPKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIMMS ILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRIESLEE EIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALASQAD LVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQET TFCSVTQAELNWAPEILPPQPPEQLGLQMCHHTQLIFLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro RAD51B mediated double-stranded DNA repair pathway regulation study by intracellular delivery of this protein.2. May be used for RAD51B protein-protein interaction mapping.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) ralted enzyme functional screening assays.4. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: RAD51B RAD51 homolog B (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RAD51B
• Synonyms: RAD51B; RAD51 homolog B (S. cerevisiae); RAD51 (S. cerevisiae) like 1 , RAD51 like 1 (S. cerevisiae) , RAD51L1; DNA repair protein RAD51 homolog 2; hREC2; R51H2; REC2; RecA-like protein; recombination repair protein; RAD51L1; MGC34245
• Gene ID: 5890
• mRNA Refseq: NM_002877
• Protein Refseq: NP_002868
• MIM: 602948
• UniProt ID: O15315
• Chromosome Location: 14q23-q24.2
• Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem
• Function: ATP binding; DNA binding; DNA-dependent ATPase activity; nucleoside-triphosphatase activity; nucleotide binding; protein binding