Recombinant Human RAD51D protein, GST-tagged
Cat.No. : | RAD51D-2156H |
Product Overview : | Recombinant Human RAD51D protein(1-253 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-253 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITR |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RAD51D RAD51 homolog D (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | RAD51D |
Synonyms | RAD51D; RAD51 homolog D (S. cerevisiae); RAD51 (S. cerevisiae) like 3 , RAD51 like 3 (S. cerevisiae) , RAD51L3; DNA repair protein RAD51 homolog 4; HsTRAD; R51H3; recombination repair protein; Trad; RAD51-like protein 3; TRAD; BROVCA4; RAD51L3; |
mRNA Refseq | NM_001142571 |
Protein Refseq | NP_001136043 |
MIM | 602954 |
UniProt ID | O75771 |
Gene ID | 5892 |
◆ Recombinant Proteins | ||
RAD51D-411H | Recombinant Human RAD51 paralog D, His-tagged | +Inquiry |
RAD51D-2156H | Recombinant Human RAD51D protein, GST-tagged | +Inquiry |
RAD51D-448H | Recombinant Full Length Human RAD51 paralog D / RAD51D Protein, His-tagged | +Inquiry |
RAD51D-5049H | Recombinant Human RAD51D, His-tagged | +Inquiry |
RAD51D-2553H | Recombinant Human RAD51D protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAD51D-2553HCL | Recombinant Human RAD51L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAD51D Products
Required fields are marked with *
My Review for All RAD51D Products
Required fields are marked with *