Recombinant Human RAD51D protein, GST-tagged

Cat.No. : RAD51D-2156H
Product Overview : Recombinant Human RAD51D protein(1-253 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability October 11, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-253 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITR
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name RAD51D RAD51 homolog D (S. cerevisiae) [ Homo sapiens ]
Official Symbol RAD51D
Synonyms RAD51D; RAD51 homolog D (S. cerevisiae); RAD51 (S. cerevisiae) like 3 , RAD51 like 3 (S. cerevisiae) , RAD51L3; DNA repair protein RAD51 homolog 4; HsTRAD; R51H3; recombination repair protein; Trad; RAD51-like protein 3; TRAD; BROVCA4; RAD51L3;
mRNA Refseq NM_001142571
Protein Refseq NP_001136043
MIM 602954
UniProt ID O75771
Gene ID 5892

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAD51D Products

Required fields are marked with *

My Review for All RAD51D Products

Required fields are marked with *

0
cart-icon
0
compare icon