Recombinant Full Length Human RAD52, GST-tagged

Cat.No. : RAD52-2668H
Product Overview : Recombinant Human RAD52 (1 a.a. - 418 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair.
Molecular Mass : 46 kDa
AA Sequence : MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLA NEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDG LKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSP SRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVC HQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RAD52 RAD52 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol RAD52
Synonyms RAD52; RAD52 homolog (S. cerevisiae); DNA repair protein RAD52 homolog; recombination protein RAD52; rhabdomyosarcoma antigen MU-RMS-40.23
Gene ID 5893
mRNA Refseq NM_134424
Protein Refseq NP_602296
MIM 600392
UniProt ID P43351
Chromosome Location 12p13-p12.2
Pathway Assembly of the RAD51-ssDNA nucleoprotein complex; DNA damage response; Double-Strand Break Repair
Function DNA binding; identical protein binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAD52 Products

Required fields are marked with *

My Review for All RAD52 Products

Required fields are marked with *

0
cart-icon