Recombinant Human RAE1, His-tagged

Cat.No. : RAE1-29369TH
Product Overview : Recombinant fragment, corresponding to amino acids 76-368 of Human RAE1 with N terminal His tag; 293 amino acids, 36kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 76-368 a.a.
Description : Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 97 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDL SSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTL KFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLI VYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGF ALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSA PQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLK TSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNP QKKNYIFLRNAAEELKPRNKK
Sequence Similarities : Belongs to the WD repeat rae1 family.Contains 4 WD repeats.
Gene Name RAE1 RAE1 RNA export 1 homolog (S. pombe) [ Homo sapiens ]
Official Symbol RAE1
Synonyms RAE1; RAE1 RNA export 1 homolog (S. pombe); RAE1 (RNA export 1, S.pombe) homolog; mRNA export factor; Mnrp41;
Gene ID 8480
mRNA Refseq NM_001015885
Protein Refseq NP_001015885
MIM 603343
Uniprot ID P78406
Chromosome Location 20
Pathway Export of Viral Ribonucleoproteins from Nucleus, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Glucose transport, organism-specific biosystem; HIV Infection, organism-specific biosystem;
Function RNA binding; microtubule binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAE1 Products

Required fields are marked with *

My Review for All RAE1 Products

Required fields are marked with *

0
cart-icon