Recombinant Human RAE1, His-tagged
Cat.No. : | RAE1-29369TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 76-368 of Human RAE1 with N terminal His tag; 293 amino acids, 36kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 76-368 a.a. |
Description : | Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 97 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDL SSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTL KFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLI VYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGF ALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSA PQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLK TSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNP QKKNYIFLRNAAEELKPRNKK |
Sequence Similarities : | Belongs to the WD repeat rae1 family.Contains 4 WD repeats. |
Gene Name | RAE1 RAE1 RNA export 1 homolog (S. pombe) [ Homo sapiens ] |
Official Symbol | RAE1 |
Synonyms | RAE1; RAE1 RNA export 1 homolog (S. pombe); RAE1 (RNA export 1, S.pombe) homolog; mRNA export factor; Mnrp41; |
Gene ID | 8480 |
mRNA Refseq | NM_001015885 |
Protein Refseq | NP_001015885 |
MIM | 603343 |
Uniprot ID | P78406 |
Chromosome Location | 20 |
Pathway | Export of Viral Ribonucleoproteins from Nucleus, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Glucose transport, organism-specific biosystem; HIV Infection, organism-specific biosystem; |
Function | RNA binding; microtubule binding; |
◆ Recombinant Proteins | ||
RAE1-2160H | Recombinant Human RAE1, His-tagged | +Inquiry |
RAE1-3408H | Recombinant Human RAE1 protein, GST-tagged | +Inquiry |
RAE1-4912R | Recombinant Rat RAE1 Protein | +Inquiry |
RAE1-4571R | Recombinant Rat RAE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAE1-29369TH | Recombinant Human RAE1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAE1-2550HCL | Recombinant Human RAE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAE1 Products
Required fields are marked with *
My Review for All RAE1 Products
Required fields are marked with *