Recombinant Human RANGAP1, His-tagged
Cat.No. : | RANGAP1-30474TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-357 of Human RanGAP1 with N terminal His tag. MWt 41kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-357 a.a. |
Description : | RanGAP1, is a homodimeric 65-kD polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state. The RANGAP1 gene encodes a 587-amino acid polypeptide. The sequence is unrelated to that of GTPase activators for other RAS-related proteins, but is 88% identical to Fug1, the murine homolog of yeast Rna1p. RanGAP1 and RCC1 control RAN-dependent transport between the nucleus and cytoplasm. RanGAP1 is a key regulator of the RAN GTP/GDP cycle. |
Conjugation : | HIS |
Tissue specificity : | Highly expressed in brain, thymus and testis. |
Form : | Lyophilised:Reconstitution with 98 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKD VIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSE LKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVE LDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGI GGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLEN DGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAF AVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFG DCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAA LAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGF NMAKVLASL |
Sequence Similarities : | Belongs to the RNA1 family.Contains 6 LRR (leucine-rich) repeats. |
Full Length : | Full L. |
Gene Name | RANGAP1 Ran GTPase activating protein 1 [ Homo sapiens ] |
Official Symbol | RANGAP1 |
Synonyms | RANGAP1; Ran GTPase activating protein 1; SD, segregation distorter homolog (Drosophila); ran GTPase-activating protein 1; Fug1; KIAA1835; |
Gene ID | 5905 |
mRNA Refseq | NM_002883 |
Protein Refseq | NP_002874 |
MIM | 602362 |
Uniprot ID | P46060 |
Chromosome Location | 22q13 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; HIV Infection, organism-specific biosystem; HIV Life Cycle, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem; |
Function | GTPase activator activity; Ran GTPase activator activity; protein binding; |
◆ Recombinant Proteins | ||
RANGAP1-1384C | Recombinant Chicken RANGAP1 | +Inquiry |
RANGAP1-7416M | Recombinant Mouse RANGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RANGAP1-4293HFL | Recombinant Full Length Human RANGAP1 protein, Flag-tagged | +Inquiry |
RANGAP1-12H | Recombinant Human RANGAP1 Protein, His-tagged | +Inquiry |
RANGAP1-6744H | Recombinant Human RANGAP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANGAP1 Products
Required fields are marked with *
My Review for All RANGAP1 Products
Required fields are marked with *