Recombinant Human RANGAP1 protein, His-tagged
Cat.No. : | RANGAP1-3117H |
Product Overview : | Recombinant Human RANGAP1 protein(2-220 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-220 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RANGAP1 Ran GTPase activating protein 1 [ Homo sapiens ] |
Official Symbol | RANGAP1 |
Synonyms | RANGAP1; Ran GTPase activating protein 1; SD, segregation distorter homolog (Drosophila); ran GTPase-activating protein 1; Fug1; KIAA1835; segregation distortion; segregation distorter homolog; SD; MGC20266; |
Gene ID | 5905 |
mRNA Refseq | NM_002883 |
Protein Refseq | NP_002874 |
MIM | 602362 |
UniProt ID | P46060 |
◆ Recombinant Proteins | ||
RANGAP1-706HF | Recombinant Full Length Human RANGAP1 Protein, GST-tagged | +Inquiry |
RANGAP1-4293HFL | Recombinant Full Length Human RANGAP1 protein, Flag-tagged | +Inquiry |
RANGAP1-42H | Recombinant Human RANGAP1 protein, MYC/DDK-tagged | +Inquiry |
RANGAP1-682H | Recombinant Human Ran GTPase Activating Protein 1, GST-tagged | +Inquiry |
RANGAP1-7416M | Recombinant Mouse RANGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANGAP1 Products
Required fields are marked with *
My Review for All RANGAP1 Products
Required fields are marked with *