Recombinant Human RANGAP1 protein, His-tagged
| Cat.No. : | RANGAP1-3117H |
| Product Overview : | Recombinant Human RANGAP1 protein(2-220 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-220 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RANGAP1 Ran GTPase activating protein 1 [ Homo sapiens ] |
| Official Symbol | RANGAP1 |
| Synonyms | RANGAP1; Ran GTPase activating protein 1; SD, segregation distorter homolog (Drosophila); ran GTPase-activating protein 1; Fug1; KIAA1835; segregation distortion; segregation distorter homolog; SD; MGC20266; |
| Gene ID | 5905 |
| mRNA Refseq | NM_002883 |
| Protein Refseq | NP_002874 |
| MIM | 602362 |
| UniProt ID | P46060 |
| ◆ Recombinant Proteins | ||
| RANGAP1-1384C | Recombinant Chicken RANGAP1 | +Inquiry |
| RANGAP1-682H | Recombinant Human Ran GTPase Activating Protein 1, GST-tagged | +Inquiry |
| RANGAP1-7416M | Recombinant Mouse RANGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RANGAP1-42H | Recombinant Human RANGAP1 protein, MYC/DDK-tagged | +Inquiry |
| RANGAP1-13916M | Recombinant Mouse RANGAP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RANGAP1-2532HCL | Recombinant Human RANGAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANGAP1 Products
Required fields are marked with *
My Review for All RANGAP1 Products
Required fields are marked with *
