Recombinant Human RAPGEF2 protein, GST-tagged

Cat.No. : RAPGEF2-7142H
Product Overview : Recombinant Human RAPGEF2 protein(1255-1400 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1255-1400 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : GSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol RAPGEF2
Synonyms RAPGEF2; Rap guanine nucleotide exchange factor (GEF) 2; PDZ domain containing guanine nucleotide exchange factor (GEF) 1 , PDZGEF1; rap guanine nucleotide exchange factor 2; DKFZP586O1422; KIAA0313; PDZ GEF1; RA GEF; Rap GEP; RA(Ras/Rap1A-associating)-GEF; neural RAP guanine nucleotide exchange protein; PDZ domain-containing guanine nucleotide exchange factor 1; PDZ domain containing guanine nucleotide exchange factor (GEF) 1; RA-GEF; NRAPGEP; PDZGEF1; Rap-GEP; CNrasGEF; PDZ-GEF1; nRap GEP;
Gene ID 9693
mRNA Refseq NM_014247
Protein Refseq NP_055062
MIM 609530
UniProt ID Q9Y4G8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAPGEF2 Products

Required fields are marked with *

My Review for All RAPGEF2 Products

Required fields are marked with *

0
cart-icon