Recombinant Human RAPGEF2 protein, GST-tagged
Cat.No. : | RAPGEF2-7142H |
Product Overview : | Recombinant Human RAPGEF2 protein(1255-1400 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1255-1400 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | GSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | RAPGEF2 |
Synonyms | RAPGEF2; Rap guanine nucleotide exchange factor (GEF) 2; PDZ domain containing guanine nucleotide exchange factor (GEF) 1 , PDZGEF1; rap guanine nucleotide exchange factor 2; DKFZP586O1422; KIAA0313; PDZ GEF1; RA GEF; Rap GEP; RA(Ras/Rap1A-associating)-GEF; neural RAP guanine nucleotide exchange protein; PDZ domain-containing guanine nucleotide exchange factor 1; PDZ domain containing guanine nucleotide exchange factor (GEF) 1; RA-GEF; NRAPGEP; PDZGEF1; Rap-GEP; CNrasGEF; PDZ-GEF1; nRap GEP; |
Gene ID | 9693 |
mRNA Refseq | NM_014247 |
Protein Refseq | NP_055062 |
MIM | 609530 |
UniProt ID | Q9Y4G8 |
◆ Recombinant Proteins | ||
RAPGEF2-7142H | Recombinant Human RAPGEF2 protein, GST-tagged | +Inquiry |
RAPGEF2-4585R | Recombinant Rat RAPGEF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAPGEF2-7143H | Recombinant Human RAPGEF2 protein, His-tagged | +Inquiry |
RAPGEF2-4926R | Recombinant Rat RAPGEF2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAPGEF2 Products
Required fields are marked with *
My Review for All RAPGEF2 Products
Required fields are marked with *
0
Inquiry Basket