Recombinant Human RAPGEF3 protein, His-tagged
| Cat.No. : | RAPGEF3-3056H |
| Product Overview : | Recombinant Human RAPGEF3 protein(43-203 aa), fused to His tag, was expressed in E. coli. |
| Availability | May 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 43-203 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEMEEELAE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RAPGEF3 Rap guanine nucleotide exchange factor (GEF) 3 [ Homo sapiens ] |
| Official Symbol | RAPGEF3 |
| Synonyms | RAPGEF3; Rap guanine nucleotide exchange factor (GEF) 3; RAP guanine nucleotide exchange factor (GEF) 3; rap guanine nucleotide exchange factor 3; bcm910; cAMP GEFI; EPAC; exchange protein directly activated by cAMP 1; EPAC 1; 9330170P05Rik; exchange factor directly activated by cAMP 1; cAMP-regulated guanine nucleotide exchange factor I; Rap1 guanine-nucleotide-exchange factor directly activated by cAMP; EPAC1; HSU79275; CAMP-GEFI; MGC21410; |
| Gene ID | 10411 |
| mRNA Refseq | NM_001098531 |
| Protein Refseq | NP_001092001 |
| MIM | 606057 |
| UniProt ID | O95398 |
| ◆ Recombinant Proteins | ||
| RAPGEF3-135H | Recombinant Human RAPGEF3, MYC/DDK-tagged | +Inquiry |
| RAPGEF3-5103HFL | Recombinant Full Length Human RAPGEF3, Flag-tagged | +Inquiry |
| RAPGEF3-1032H | Recombinant Human Rap guanine nucleotide exchange factor (GEF) 3 | +Inquiry |
| RAPGEF3-2181H | Recombinant Human RAPGEF3, GST-tagged | +Inquiry |
| Rapgef3-5377M | Recombinant Mouse Rapgef3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAPGEF3-2521HCL | Recombinant Human RAPGEF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAPGEF3 Products
Required fields are marked with *
My Review for All RAPGEF3 Products
Required fields are marked with *
