Recombinant Human RAPGEF3 protein, His-tagged

Cat.No. : RAPGEF3-3056H
Product Overview : Recombinant Human RAPGEF3 protein(43-203 aa), fused to His tag, was expressed in E. coli.
Availability May 24, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 43-203 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEMEEELAE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name RAPGEF3 Rap guanine nucleotide exchange factor (GEF) 3 [ Homo sapiens ]
Official Symbol RAPGEF3
Synonyms RAPGEF3; Rap guanine nucleotide exchange factor (GEF) 3; RAP guanine nucleotide exchange factor (GEF) 3; rap guanine nucleotide exchange factor 3; bcm910; cAMP GEFI; EPAC; exchange protein directly activated by cAMP 1; EPAC 1; 9330170P05Rik; exchange factor directly activated by cAMP 1; cAMP-regulated guanine nucleotide exchange factor I; Rap1 guanine-nucleotide-exchange factor directly activated by cAMP; EPAC1; HSU79275; CAMP-GEFI; MGC21410;
Gene ID 10411
mRNA Refseq NM_001098531
Protein Refseq NP_001092001
MIM 606057
UniProt ID O95398

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAPGEF3 Products

Required fields are marked with *

My Review for All RAPGEF3 Products

Required fields are marked with *

0
cart-icon
0
compare icon