Recombinant Human RARRES2 Protein, His-tagged
Cat.No. : | RARRES2-001H |
Product Overview : | Recombinant Human RARRES2 Protein (21-157aa) with a His tag at C-terminus was expressed in insect cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 21-157 a.a. |
Description : | This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. |
Form : | Liquid |
Molecular Mass : | 16.9kDa (146aa) 18-28kDa (SDS-PAGE under reducing conditions.) |
AA Sequence : | ADPELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSHHHHHH |
Endotoxin : | < 1.0 EU per 1ug of protein (determined by LAL method) |
Purity : | > 90% by SDS - PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Gene Name | RARRES2 retinoic acid receptor responder 2 [ Homo sapiens (human) ] |
Official Symbol | RARRES2 |
Synonyms | RARRES2; retinoic acid receptor responder 2; TIG2; HP10433; retinoic acid receptor responder protein 2; RAR-responsive protein TIG2; chemerin; retinoic acid receptor responder (tazarotene induced) 2; tazarotene-induced gene 2 protein |
Gene ID | 5919 |
mRNA Refseq | NM_002889 |
Protein Refseq | NP_002880 |
MIM | 601973 |
UniProt ID | Q99969 |
◆ Recombinant Proteins | ||
RARRES2-4546H | Recombinant Human Retinoic Acid Receptor Responder (Tazarotene Induced) 2 | +Inquiry |
Rarres2-5655R | Recombinant Rat Rarres2 protein, His-tagged | +Inquiry |
RARRES2-7426M | Recombinant Mouse RARRES2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RARRES2-7008H | Recombinant Human RARRES2, Fc tagged | +Inquiry |
RARRES2-1472H | Recombinant Human RARRES2 Protein (Glu21-Ser157), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RARRES2-2511HCL | Recombinant Human RARRES2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RARRES2 Products
Required fields are marked with *
My Review for All RARRES2 Products
Required fields are marked with *