Recombinant Human RARRES2 Protein, His-tagged

• Cat.No.: RARRES2-001H
• Product Overview: Recombinant Human RARRES2 Protein (21-157aa) with a His tag at C-terminus was expressed in insect cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 21-157 a.a.
• Description: This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi.
• Form: Liquid
• Molecular Mass: 16.9kDa (146aa)
  18-28kDa (SDS-PAGE under reducing conditions.)
• AA Sequence: ADPELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSHHHHHH
• Endotoxin: < 1.0 EU per 1ug of protein (determined by LAL method)
• Purity: > 90% by SDS - PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.

Gene Information

• Gene Name: RARRES2 retinoic acid receptor responder 2 [ Homo sapiens (human) ]
• Official Symbol: RARRES2
• Synonyms: RARRES2; retinoic acid receptor responder 2; TIG2; HP10433; retinoic acid receptor responder protein 2; RAR-responsive protein TIG2; chemerin; retinoic acid receptor responder (tazarotene induced) 2; tazarotene-induced gene 2 protein
• Gene ID: 5919
• mRNA Refseq: NM_002889
• Protein Refseq: NP_002880
• MIM: 601973
• UniProt ID: Q99969