Recombinant Human RASL10B protein, His-tagged
Cat.No. : | RASL10B-5744H |
Product Overview : | Recombinant Human RASL10B protein(1-203 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-203 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNTLQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RASL10B RAS-like, family 10, member B [ Homo sapiens ] |
Official Symbol | RASL10B |
Synonyms | RASL10B; RAS-like, family 10, member B; ras-like protein family member 10B; RRP17; VTS58635; Ras-related protein 17; ras-like protein VTS58635; MGC47540; |
Gene ID | 91608 |
mRNA Refseq | NM_033315 |
Protein Refseq | NP_201572 |
MIM | 612128 |
UniProt ID | Q96S79 |
◆ Recombinant Proteins | ||
RASL10B-3613R | Recombinant Rhesus Macaque RASL10B Protein, His (Fc)-Avi-tagged | +Inquiry |
RASL10B-7442M | Recombinant Mouse RASL10B Protein, His (Fc)-Avi-tagged | +Inquiry |
RASL10B-13958M | Recombinant Mouse RASL10B Protein | +Inquiry |
RASL10B-3796R | Recombinant Rhesus monkey RASL10B Protein, His-tagged | +Inquiry |
RASL10B-5744H | Recombinant Human RASL10B protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RASL10B Products
Required fields are marked with *
My Review for All RASL10B Products
Required fields are marked with *