Recombinant Human RASSF5, His-tagged

Cat.No. : RASSF5-29658TH
Product Overview : Recombinant fragment, corresponding to amino acids 35-260 of Human NORE1 Isoform 2 with an N terminal His tag; MWt 26 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 35-260 a.a.
Description : This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Tissue specificity : Widely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors.
Form : Lyophilised:Reconstitute with 123 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLG MKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAI KEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQ GLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRP LYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES
Sequence Similarities : Contains 1 phorbol-ester/DAG-type zinc finger.Contains 1 Ras-associating domain.Contains 1 SARAH domain.
Gene Name RASSF5 Ras association (RalGDS/AF-6) domain family member 5 [ Homo sapiens ]
Official Symbol RASSF5
Synonyms RASSF5; Ras association (RalGDS/AF-6) domain family member 5; ras association domain-containing protein 5; Maxp1; NORE1; RAPL;
Gene ID 83593
mRNA Refseq NM_182663
Protein Refseq NP_872604
MIM 607020
Uniprot ID Q8WWW0
Chromosome Location 1q31
Pathway Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Non-small cell lung cancer, organism-specific biosystem; Non-small cell lung cancer, conserved biosystem; Pathways in cancer, organism-specific biosystem;
Function identical protein binding; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RASSF5 Products

Required fields are marked with *

My Review for All RASSF5 Products

Required fields are marked with *

0
cart-icon
0
compare icon