Recombinant Human RASSF5, His-tagged
Cat.No. : | RASSF5-29658TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 35-260 of Human NORE1 Isoform 2 with an N terminal His tag; MWt 26 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 35-260 a.a. |
Description : | This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras, Rap1, and several other Ras-like small GTPases. The protein regulates lymphocyte adhesion and suppresses cell growth in response to activated Rap1 or Ras. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors. |
Form : | Lyophilised:Reconstitute with 123 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLG MKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAI KEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQ GLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRP LYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRES |
Sequence Similarities : | Contains 1 phorbol-ester/DAG-type zinc finger.Contains 1 Ras-associating domain.Contains 1 SARAH domain. |
Gene Name | RASSF5 Ras association (RalGDS/AF-6) domain family member 5 [ Homo sapiens ] |
Official Symbol | RASSF5 |
Synonyms | RASSF5; Ras association (RalGDS/AF-6) domain family member 5; ras association domain-containing protein 5; Maxp1; NORE1; RAPL; |
Gene ID | 83593 |
mRNA Refseq | NM_182663 |
Protein Refseq | NP_872604 |
MIM | 607020 |
Uniprot ID | Q8WWW0 |
Chromosome Location | 1q31 |
Pathway | Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem; Non-small cell lung cancer, organism-specific biosystem; Non-small cell lung cancer, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function | identical protein binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
RASSF5-29726TH | Recombinant Human RASSF5 | +Inquiry |
RASSF5-5443H | Recombinant Human RASSF5, MYC/DDK-tagged | +Inquiry |
RASSF5-4638H | Recombinant Human RASSF5 protein, GST-tagged | +Inquiry |
Rassf5-5397M | Recombinant Mouse Rassf5 Protein, Myc/DDK-tagged | +Inquiry |
RASSF5-1830C | Recombinant Chicken RASSF5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASSF5-2495HCL | Recombinant Human RASSF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RASSF5 Products
Required fields are marked with *
My Review for All RASSF5 Products
Required fields are marked with *