Recombinant Human RAVER2 Protein (1-140 aa), His-tagged
Cat.No. : | RAVER2-1715H |
Product Overview : | Recombinant Human RAVER2 Protein (1-140 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-140 aa |
Description : | May bind single-stranded nucleic acids.Curated |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.0 kDa |
AA Sequence : | MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | RAVER2 ribonucleoprotein, PTB-binding 2 [ Homo sapiens ] |
Official Symbol | RAVER2 |
Synonyms | RAVER2; FLJ10770; KIAA1579; protein raver-2; DKFZp762D1011; |
Gene ID | 55225 |
mRNA Refseq | NM_018211 |
Protein Refseq | NP_060681 |
MIM | 609953 |
UniProt ID | Q9HCJ3 |
◆ Recombinant Proteins | ||
RAVER2-13973M | Recombinant Mouse RAVER2 Protein | +Inquiry |
RAVER2-7454M | Recombinant Mouse RAVER2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAVER2-1715H | Recombinant Human RAVER2 Protein (1-140 aa), His-tagged | +Inquiry |
RAVER2-1131H | Recombinant Human RAVER2 Protein (2-691 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAVER2 Products
Required fields are marked with *
My Review for All RAVER2 Products
Required fields are marked with *