Recombinant Human RAVER2 Protein (1-140 aa), His-tagged

• Cat.No.: RAVER2-1715H
• Product Overview: Recombinant Human RAVER2 Protein (1-140 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-140 aa
• Description: May bind single-stranded nucleic acids.Curated
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 17.0 kDa
• AA Sequence: MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: RAVER2 ribonucleoprotein, PTB-binding 2 [ Homo sapiens ]
• Official Symbol: RAVER2
• Synonyms: RAVER2; FLJ10770; KIAA1579; protein raver-2; DKFZp762D1011
• Gene ID: 55225
• mRNA Refseq: NM_018211
• Protein Refseq: NP_060681
• MIM: 609953
• UniProt ID: Q9HCJ3