Recombinant Human RAVER2 Protein (1-140 aa), His-tagged

Cat.No. : RAVER2-1715H
Product Overview : Recombinant Human RAVER2 Protein (1-140 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-140 aa
Description : May bind single-stranded nucleic acids.Curated
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.0 kDa
AA Sequence : MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name RAVER2 ribonucleoprotein, PTB-binding 2 [ Homo sapiens ]
Official Symbol RAVER2
Synonyms RAVER2; FLJ10770; KIAA1579; protein raver-2; DKFZp762D1011;
Gene ID 55225
mRNA Refseq NM_018211
Protein Refseq NP_060681
MIM 609953
UniProt ID Q9HCJ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RAVER2 Products

Required fields are marked with *

My Review for All RAVER2 Products

Required fields are marked with *

0
cart-icon