Recombinant Human RBAK protein, GST-tagged

• Cat.No.: RBAK-3612H
• Product Overview: Recombinant Human RBAK protein(94-151 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 94-151 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: NEDKHSRQAACINSKTLTEEKENTFSQIYMETSLVPSSIIAHNCVSCGKNLESISQLI
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RBAK RB-associated KRAB zinc finger [ Homo sapiens ]
• Official Symbol: RBAK
• Synonyms: RBAK; RB-associated KRAB zinc finger; RB-associated KRAB zinc finger protein; ZNF769; zinc finger protein 769; RB-associated KRAB repressor
• Gene ID: 57786
• mRNA Refseq: NM_001204456
• Protein Refseq: NP_001191385
• MIM: 608191
• UniProt ID: Q9NYW8