Recombinant Human RBBP6 protein, GST-tagged

Cat.No. : RBBP6-23H
Product Overview : Recombinant Human RBBP6(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 118 a.a.
Description : The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.6 kDa
AA Sequence : MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name RBBP6 retinoblastoma binding protein 6 [ Homo sapiens ]
Official Symbol RBBP6
Synonyms RBBP6; retinoblastoma binding protein 6; E3 ubiquitin-protein ligase RBBP6; P2P R; PACT; proliferation potential related protein; SNAMA; protein P2P-R; RB-binding Q-protein 1; retinoblastoma-binding Q protein 1; proliferation potential-related protein; p53-associated cellular protein of testis; retinoblastoma-binding protein 6, isoform 3; MY038; P2P-R; RBQ-1; DKFZp686P0638; DKFZp761B2423;
Gene ID 5930
mRNA Refseq NM_032626
Protein Refseq NP_116015
MIM 600938
UniProt ID Q7Z6E9
Chromosome Location 16p12.2
Function ligase activity; metal ion binding; nucleic acid binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBBP6 Products

Required fields are marked with *

My Review for All RBBP6 Products

Required fields are marked with *

0
cart-icon