"RBBP6" Related Products

Expand

Recombinant Human RBBP6 protein, GST-tagged

Cat.No.: RBBP6-23H
Product Overview: Recombinant Human RBBP6(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 39.6 kDa
Protein length: 1 a.a. - 118 a.a.
AA Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: RBBP6 retinoblastoma binding protein 6 [ Homo sapiens ]
Official Symbol: RBBP6
Synonyms: RBBP6; retinoblastoma binding protein 6; E3 ubiquitin-protein ligase RBBP6; P2P R; PACT; proliferation potential related protein; SNAMA; protein P2P-R; RB-binding Q-protein 1; retinoblastoma-binding Q protein 1; proliferation potential-related protein; p53-associated cellular protein of testis; retinoblastoma-binding protein 6, isoform 3; MY038; P2P-R; RBQ-1; DKFZp686P0638; DKFZp761B2423;
Gene ID: 5930
mRNA Refseq: NM_032626
Protein Refseq: NP_116015
MIM: 600938
UniProt ID: Q7Z6E9
Chromosome Location: 16p12.2
Function: ligase activity; metal ion binding; nucleic acid binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.