Recombinant Human RBBP6 protein, GST-tagged

• Cat.No.: RBBP6-23H
• Product Overview: Recombinant Human RBBP6(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 118 a.a.
• Description: The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.6 kDa
• AA Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: RBBP6 retinoblastoma binding protein 6 [ Homo sapiens ]
• Official Symbol: RBBP6
• Synonyms: RBBP6; retinoblastoma binding protein 6; E3 ubiquitin-protein ligase RBBP6; P2P R; PACT; proliferation potential related protein; SNAMA; protein P2P-R; RB-binding Q-protein 1; retinoblastoma-binding Q protein 1; proliferation potential-related protein; p53-associated cellular protein of testis; retinoblastoma-binding protein 6, isoform 3; MY038; P2P-R; RBQ-1; DKFZp686P0638; DKFZp761B2423
• Gene ID: 5930
• mRNA Refseq: NM_032626
• Protein Refseq: NP_116015
• MIM: 600938
• UniProt ID: Q7Z6E9
• Chromosome Location: 16p12.2
• Function: ligase activity; metal ion binding; nucleic acid binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding