Recombinant Human RBBP7 Protein (1-425 aa), His-SUMO-tagged
Cat.No. : | RBBP7-1010H |
Product Overview : | Recombinant Human RBBP7 Protein (1-425 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-425 aa |
Description : | Core histone-binding subunit that may target chromatin rodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the type B histone acetyltransferase (HAT) complex, which is required for chromatin assbly following DNA replication; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome rodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome rodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome rodeling factor) complex. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 63.8 kDa |
AA Sequence : | MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | RBBP7 retinoblastoma binding protein 7 [ Homo sapiens ] |
Official Symbol | RBBP7 |
Synonyms | RBBP7; RbAp46; RBBP-7; MGC138867; MGC138868; |
Gene ID | 5931 |
mRNA Refseq | NM_001198719 |
Protein Refseq | NP_001185648 |
MIM | 300825 |
UniProt ID | Q16576 |
◆ Recombinant Proteins | ||
RBBP7-428HF | Recombinant Full Length Human RBBP7 Protein | +Inquiry |
RBBP7-5864H | Recombinant Human RBBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBBP7-845C | Recombinant Cynomolgus RBBP7 Protein, His-tagged | +Inquiry |
RBBP7-4950R | Recombinant Rat RBBP7 Protein | +Inquiry |
RBBP7-13978M | Recombinant Mouse RBBP7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBBP7-2489HCL | Recombinant Human RBBP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBBP7 Products
Required fields are marked with *
My Review for All RBBP7 Products
Required fields are marked with *
0
Inquiry Basket