Recombinant Human RBM12, His-tagged

• Cat.No.: RBM12-28122TH
• Product Overview: Recombinant fragment, corresponding to amino acids 460-633 of Human RBM12 with N terminal His tag; 174 amino acids, 20kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 460-633 a.a.
• Description: This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5 UTR results in four transcript variants. All variants encode the same protein.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 103 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: IYIAYGPNGKATGEGFVEFRNEADYKAALCRHKQYMGNRF IQVHPITKKGMLEKIDMIRKRLQNFSYDQREMILNPEG DVNSAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAF VHVVTLEDMREIEKNPPA

Gene Information

• Gene Name: RBM12 RNA binding motif protein 12 [ Homo sapiens ]
• Official Symbol: RBM12
• Synonyms: RBM12; RNA binding motif protein 12; RNA-binding protein 12; HRIHFB2091; KIAA0765; SWAN
• Gene ID: 10137
• mRNA Refseq: NM_001198838
• Protein Refseq: NP_001185767
• MIM: 607179
• Uniprot ID: Q9NTZ6
• Chromosome Location: 20q11.21
• Function: RNA binding; nucleotide binding