Recombinant Human RBM12, His-tagged

Cat.No. : RBM12-28122TH
Product Overview : Recombinant fragment, corresponding to amino acids 460-633 of Human RBM12 with N terminal His tag; 174 amino acids, 20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 460-633 a.a.
Description : This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5 UTR results in four transcript variants. All variants encode the same protein.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 103 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IYIAYGPNGKATGEGFVEFRNEADYKAALCRHKQYMGNRF IQVHPITKKGMLEKIDMIRKRLQNFSYDQREMILNPEG DVNSAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAF VHVVTLEDMREIEKNPPA
Gene Name RBM12 RNA binding motif protein 12 [ Homo sapiens ]
Official Symbol RBM12
Synonyms RBM12; RNA binding motif protein 12; RNA-binding protein 12; HRIHFB2091; KIAA0765; SWAN;
Gene ID 10137
mRNA Refseq NM_001198838
Protein Refseq NP_001185767
MIM 607179
Uniprot ID Q9NTZ6
Chromosome Location 20q11.21
Function RNA binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBM12 Products

Required fields are marked with *

My Review for All RBM12 Products

Required fields are marked with *

0
cart-icon