Recombinant Human RBM18 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RBM18-4010H |
Product Overview : | RBM18 MS Standard C13 and N15-labeled recombinant protein (NP_149108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | RBM18 (RNA Binding Motif Protein 18) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and nucleotide binding. |
Molecular Mass : | 21.5 kDa |
AA Sequence : | MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RBM18 RNA binding motif protein 18 [ Homo sapiens (human) ] |
Official Symbol | RBM18 |
Synonyms | RBM18; RNA binding motif protein 18; probable RNA-binding protein 18; MGC2734; RNA-binding motif protein 18; |
Gene ID | 92400 |
mRNA Refseq | NM_033117 |
Protein Refseq | NP_149108 |
UniProt ID | Q96H35 |
◆ Recombinant Proteins | ||
RBM18-3813R | Recombinant Rhesus monkey RBM18 Protein, His-tagged | +Inquiry |
RBM18-633H | Recombinant Human RNA binding motif protein 18, His-tagged | +Inquiry |
RBM18-3630R | Recombinant Rhesus Macaque RBM18 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBM18-656H | Recombinant Human RBM18 Protein, MYC/DDK-tagged | +Inquiry |
RBM18-13994M | Recombinant Mouse RBM18 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBM18 Products
Required fields are marked with *
My Review for All RBM18 Products
Required fields are marked with *
0
Inquiry Basket