Recombinant Human RBM18 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RBM18-4010H
• Product Overview: RBM18 MS Standard C13 and N15-labeled recombinant protein (NP_149108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RBM18 (RNA Binding Motif Protein 18) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and nucleotide binding.
• Molecular Mass: 21.5 kDa
• AA Sequence: MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RBM18 RNA binding motif protein 18 [ Homo sapiens (human) ]
• Official Symbol: RBM18
• Synonyms: RBM18; RNA binding motif protein 18; probable RNA-binding protein 18; MGC2734; RNA-binding motif protein 18
• Gene ID: 92400
• mRNA Refseq: NM_033117
• Protein Refseq: NP_149108
• UniProt ID: Q96H35