Recombinant Human RBM3 protein, His-SUMO-tagged

Cat.No. : RBM3-3413H
Product Overview : Recombinant Human RBM3 protein(P98179)(1-157aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-157aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 33.2 kDa
AA Sequence : MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ]
Official Symbol RBM3
Synonyms RBM3; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; putative RNA-binding protein 3; IS1 RNPL; RNA-binding motif protein 3; RNPL; IS1-RNPL;
Gene ID 5935
mRNA Refseq NM_006743
Protein Refseq NP_006734
MIM 300027
UniProt ID P98179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBM3 Products

Required fields are marked with *

My Review for All RBM3 Products

Required fields are marked with *

0
cart-icon