Recombinant Human RBM3 protein, His-SUMO-tagged
Cat.No. : | RBM3-3413H |
Product Overview : | Recombinant Human RBM3 protein(P98179)(1-157aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-157aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.2 kDa |
AA Sequence : | MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ] |
Official Symbol | RBM3 |
Synonyms | RBM3; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; putative RNA-binding protein 3; IS1 RNPL; RNA-binding motif protein 3; RNPL; IS1-RNPL; |
Gene ID | 5935 |
mRNA Refseq | NM_006743 |
Protein Refseq | NP_006734 |
MIM | 300027 |
UniProt ID | P98179 |
◆ Recombinant Proteins | ||
RBM3-545H | Recombinant Human RBM3 Protein, His-tagged | +Inquiry |
RBM3-3817R | Recombinant Rhesus monkey RBM3 Protein, His-tagged | +Inquiry |
RBM3-3413H | Recombinant Human RBM3 protein, His-SUMO-tagged | +Inquiry |
RBM3-2214H | Recombinant Human RBM3, GST-tagged | +Inquiry |
RBM3-1500H | Recombinant Human RBM3 Protein (1-157 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM3-2474HCL | Recombinant Human RBM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBM3 Products
Required fields are marked with *
My Review for All RBM3 Products
Required fields are marked with *
0
Inquiry Basket