Recombinant Human RBM39 protein, GST-tagged
| Cat.No. : | RBM39-2216H |
| Product Overview : | Recombinant Human RBM39 protein(328-530 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 328-530 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RBM39 RNA binding motif protein 39 [ Homo sapiens ] |
| Official Symbol | RBM39 |
| Synonyms | RBM39; RNA binding motif protein 39; RNA binding region (RNP1, RRM) containing 2 , RNPC2; RNA-binding protein 39; CAPER; CC1.3; fSAP59; functional spliceosome associated protein 59; HCC1; splicing factor HCC1; hepatocellular carcinoma protein 1; RNA-binding region (RNP1, RRM) containing 2; functional spliceosome-associated protein 59; coactivator of activating protein-1 and estrogen receptors; RNPC2; FSAP59; CAPERalpha; FLJ44170; DKFZp781C0423; |
| Gene ID | 9584 |
| mRNA Refseq | NM_001242599 |
| Protein Refseq | NP_001229528 |
| MIM | 604739 |
| UniProt ID | Q14498 |
| ◆ Recombinant Proteins | ||
| RBM39-14005M | Recombinant Mouse RBM39 Protein | +Inquiry |
| RBM39-2216H | Recombinant Human RBM39 protein, GST-tagged | +Inquiry |
| RBM39-246H | Recombinant Human RBM39 protein, GST-tagged | +Inquiry |
| RBM39-245H | Recombinant Human RBM39 protein, GST-tagged | +Inquiry |
| RBM39-7480M | Recombinant Mouse RBM39 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBM39-2470HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
| RBM39-2471HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM39 Products
Required fields are marked with *
My Review for All RBM39 Products
Required fields are marked with *
