Recombinant Human RBM39 protein, GST-tagged

Cat.No. : RBM39-2216H
Product Overview : Recombinant Human RBM39 protein(328-530 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability November 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 328-530 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name RBM39 RNA binding motif protein 39 [ Homo sapiens ]
Official Symbol RBM39
Synonyms RBM39; RNA binding motif protein 39; RNA binding region (RNP1, RRM) containing 2 , RNPC2; RNA-binding protein 39; CAPER; CC1.3; fSAP59; functional spliceosome associated protein 59; HCC1; splicing factor HCC1; hepatocellular carcinoma protein 1; RNA-binding region (RNP1, RRM) containing 2; functional spliceosome-associated protein 59; coactivator of activating protein-1 and estrogen receptors; RNPC2; FSAP59; CAPERalpha; FLJ44170; DKFZp781C0423;
Gene ID 9584
mRNA Refseq NM_001242599
Protein Refseq NP_001229528
MIM 604739
UniProt ID Q14498

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBM39 Products

Required fields are marked with *

My Review for All RBM39 Products

Required fields are marked with *

0
cart-icon
0
compare icon