Recombinant Human RBM5, His-tagged
| Cat.No. : | RBM5-31232TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 582-815 of Human RBM5 with an N terminal His tag. Observed mwt: 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 582-815 a.a. |
| Description : | This gene is a candidate tumor suppressor gene which encodes a nuclear RNA binding protein that is a component of the spliceosome A complex. The encoded protein plays a role in the induction of cell cycle arrest and apoptosis through pre-mRNA splicing of multiple target genes including the tumor suppressor protein p53. This gene is located within the tumor suppressor region 3p21.3, and may play a role in the inhibition of tumor transformation and progression of several malignancies including lung cancer. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 70 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYS GDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNK DALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPT KDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEA QVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME |
| Gene Name | RBM5 RNA binding motif protein 5 [ Homo sapiens ] |
| Official Symbol | RBM5 |
| Synonyms | RBM5; RNA binding motif protein 5; RNA-binding protein 5; H37; LUCA15; |
| Gene ID | 10181 |
| mRNA Refseq | NM_005778 |
| Protein Refseq | NP_005769 |
| MIM | 606884 |
| Uniprot ID | P52756 |
| Chromosome Location | 3p21.3 |
| Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem; |
| Function | DNA binding; RNA binding; mRNA binding; metal ion binding; nucleotide binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM5 Products
Required fields are marked with *
My Review for All RBM5 Products
Required fields are marked with *




