Recombinant Human RBM5, His-tagged

• Cat.No.: RBM5-31232TH
• Product Overview: Recombinant fragment, corresponding to amino acids 582-815 of Human RBM5 with an N terminal His tag. Observed mwt: 33 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 582-815 a.a.
• Description: This gene is a candidate tumor suppressor gene which encodes a nuclear RNA binding protein that is a component of the spliceosome A complex. The encoded protein plays a role in the induction of cell cycle arrest and apoptosis through pre-mRNA splicing of multiple target genes including the tumor suppressor protein p53. This gene is located within the tumor suppressor region 3p21.3, and may play a role in the inhibition of tumor transformation and progression of several malignancies including lung cancer.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 70 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GFALFEKKGALAERQQLIPELVRNGDEENPLKRGLVAAYS GDSDNEEELVERLESEEEKLADWKKMACLLCRRQFPNK DALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPPEPKRKKQFDAGTVNYEQPT KDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEA QVRLKGAGLGAKGSAYGLSGADSYKDAVRKAMFARFTEME

Gene Information

• Gene Name: RBM5 RNA binding motif protein 5 [ Homo sapiens ]
• Official Symbol: RBM5
• Synonyms: RBM5; RNA binding motif protein 5; RNA-binding protein 5; H37; LUCA15
• Gene ID: 10181
• mRNA Refseq: NM_005778
• Protein Refseq: NP_005769
• MIM: 606884
• Uniprot ID: P52756
• Chromosome Location: 3p21.3
• Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem
• Function: DNA binding; RNA binding; mRNA binding; metal ion binding; nucleotide binding