Recombinant Human RBM6, His-tagged
Cat.No. : | RBM6-30932TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 152-386 of Human RBM6 with N terminal His tag. Observed mwt: 27 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Description : | RNA-binding protein 6 is a protein that in humans is encoded by the RBM6 gene. RBM6 orthologshave been identified in all mammals for which complete genome data are available. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 93 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDLDFRGRDGS HADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKD GTQVDFRGRGSGTTDLDFRDRDTPHSDFRGRHRSRTDQDF RGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSG MNVNRREESTHDHTIERPAFGIQKGEFEHSETREGETQ GVAFEHESPADFQNSQSPVQDQDKSQLSGREEQSSDAGLF K |
Protein length : | 152-386 |
Gene Name : | RBM6 RNA binding motif protein 6 [ Homo sapiens ] |
Official Symbol : | RBM6 |
Synonyms : | RBM6; RNA binding motif protein 6; RNA-binding protein 6; 3G2; DEF 3; DEF3; g16; NY LU 12; |
Gene ID : | 10180 |
mRNA Refseq : | NM_001167582 |
Protein Refseq : | NP_001161054 |
MIM : | 606886 |
Uniprot ID : | P78332 |
Chromosome Location : | 3p21.3 |
Function : | DNA binding; RNA binding; nucleic acid binding; nucleotide binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
RBM6-230H | Recombinant Human RBM6 protein, GST-tagged | +Inquiry |
RBM6-2301C | Recombinant Chicken RBM6 | +Inquiry |
◆ Lysates | ||
RBM6-1485HCL | Recombinant Human RBM6 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RBM6 Products
Required fields are marked with *
My Review for All RBM6 Products
Required fields are marked with *
0
Inquiry Basket