Recombinant Human RBM6, His-tagged
| Cat.No. : | RBM6-30932TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 152-386 of Human RBM6 with N terminal His tag. Observed mwt: 27 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 152-386 a.a. |
| Description : | RNA-binding protein 6 is a protein that in humans is encoded by the RBM6 gene. RBM6 orthologshave been identified in all mammals for which complete genome data are available. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 93 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | HMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDLDFRGRDGS HADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKD GTQVDFRGRGSGTTDLDFRDRDTPHSDFRGRHRSRTDQDF RGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSG MNVNRREESTHDHTIERPAFGIQKGEFEHSETREGETQ GVAFEHESPADFQNSQSPVQDQDKSQLSGREEQSSDAGLF K |
| Gene Name | RBM6 RNA binding motif protein 6 [ Homo sapiens ] |
| Official Symbol | RBM6 |
| Synonyms | RBM6; RNA binding motif protein 6; RNA-binding protein 6; 3G2; DEF 3; DEF3; g16; NY LU 12; |
| Gene ID | 10180 |
| mRNA Refseq | NM_001167582 |
| Protein Refseq | NP_001161054 |
| MIM | 606886 |
| Uniprot ID | P78332 |
| Chromosome Location | 3p21.3 |
| Function | DNA binding; RNA binding; nucleic acid binding; nucleotide binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| RBM6-230H | Recombinant Human RBM6 protein, GST-tagged | +Inquiry |
| RBM6-2301C | Recombinant Chicken RBM6 | +Inquiry |
| RBM6-30932TH | Recombinant Human RBM6, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBM6-1485HCL | Recombinant Human RBM6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM6 Products
Required fields are marked with *
My Review for All RBM6 Products
Required fields are marked with *
