Recombinant Human RBM6 protein, GST-tagged
Cat.No. : | RBM6-230H |
Product Overview : | Recombinant Human RBM6 protein(NP_001161054)(302-601 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 302-601 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | LPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | RBM6 RNA binding motif protein 6 [ Homo sapiens ] |
Official Symbol | RBM6 |
Synonyms | RBM6; RNA binding motif protein 6; RNA-binding protein 6; 3G2; DEF 3; DEF3; g16; NY LU 12; RNA-binding protein DEF-3; RNA-binding motif protein 6; lung cancer antigen NY-LU-12; lung cancer protooncogene 11; DEF-3; HLC-11; NY-LU-12; FLJ36517; FLJ39446; FLJ42036; DKFZp686B0877; |
Gene ID | 10180 |
mRNA Refseq | NM_001167582 |
Protein Refseq | NP_001161054 |
MIM | 606886 |
UniProt ID | P78332 |
◆ Recombinant Proteins | ||
RBM6-30932TH | Recombinant Human RBM6, His-tagged | +Inquiry |
RBM6-230H | Recombinant Human RBM6 protein, GST-tagged | +Inquiry |
RBM6-2301C | Recombinant Chicken RBM6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM6-1485HCL | Recombinant Human RBM6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM6 Products
Required fields are marked with *
My Review for All RBM6 Products
Required fields are marked with *