Recombinant Human RBM6 protein, GST-tagged

Cat.No. : RBM6-230H
Product Overview : Recombinant Human RBM6 protein(NP_001161054)(302-601 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 302-601 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : LPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
Gene Name RBM6 RNA binding motif protein 6 [ Homo sapiens ]
Official Symbol RBM6
Synonyms RBM6; RNA binding motif protein 6; RNA-binding protein 6; 3G2; DEF 3; DEF3; g16; NY LU 12; RNA-binding protein DEF-3; RNA-binding motif protein 6; lung cancer antigen NY-LU-12; lung cancer protooncogene 11; DEF-3; HLC-11; NY-LU-12; FLJ36517; FLJ39446; FLJ42036; DKFZp686B0877;
Gene ID 10180
mRNA Refseq NM_001167582
Protein Refseq NP_001161054
MIM 606886
UniProt ID P78332

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBM6 Products

Required fields are marked with *

My Review for All RBM6 Products

Required fields are marked with *

0
cart-icon