Recombinant Human RBMXL2 Protein, GST-tagged
Cat.No. : | RBMXL2-4902H |
Product Overview : | Human HNRNPG-T partial ORF ( NP_055284, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-90 a.a. |
Description : | This gene belongs to the HNRPG subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind RNAs. This gene is intronless and is thought to be derived from a processed retroposon. However, unlike many retroposon-derived genes, this gene is not a pseudogene. The encoded protein has similarity to HNRPG and RBMY proteins and it is suggested to replace HNRPG protein function during meiotic prophase or act as a germ cell-specific splicing regulator. It primarily localizes to the nuclei of meiotic spermatocytes. This gene is a candidate for autosomal male infertility. [provided by RefSeq |
Molecular Mass : | 35.64 kDa |
AA Sequence : | MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIKVAQATKPAFE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RBMXL2 RNA binding motif protein, X-linked-like 2 [ Homo sapiens ] |
Official Symbol | RBMXL2 |
Synonyms | RBMXL2; RNA binding motif protein, X-linked-like 2; RNA-binding motif protein, X-linked-like-2; heterogeneous nuclear ribonucleoprotein G T; HNRNPG T; HNRPGT; hnRNP G-T; testes specific heterogenous nuclear ribonucleoprotein G T; testes-specific heterogenous nuclear ribonucleoprotein G-T; testis-specific heterogeneous nuclear ribonucleoprotein G-T; HNRNPGT; HNRNPG-T; |
Gene ID | 27288 |
mRNA Refseq | NM_014469 |
Protein Refseq | NP_055284 |
MIM | 605444 |
UniProt ID | O75526 |
◆ Recombinant Proteins | ||
RBMXL2-849C | Recombinant Cynomolgus RBMXL2 Protein, His-tagged | +Inquiry |
RBMXL2-5744H | Recombinant Human RBMXL2 protein, GST-tagged | +Inquiry |
RBMXL2-592C | Recombinant Cynomolgus Monkey RBMXL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBMXL2-4902H | Recombinant Human RBMXL2 Protein, GST-tagged | +Inquiry |
RBMXL2-5745H | Recombinant Human RBMXL2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBMXL2 Products
Required fields are marked with *
My Review for All RBMXL2 Products
Required fields are marked with *