Recombinant Human RBP1, His-tagged

• Cat.No.: RBP1-30007TH
• Product Overview: Recombinant full length Human RBP1 protein, with an N terminal His tag; 220 amino acids with tag; predicted Mwt: 24.7 kDa inclusive of tag

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 197 amino acids
• Description: This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Molecular Weight: 24.700kDa inclusive of tags
• Tissue specificity: Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:20% Glycerol, 0.32% Tris HCl, 0.03% DTT, 1.17% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMDPPAGFVRAGNPAVAA PQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWL QSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIAN LLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDL TGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDE LHLEMRVEGVVCKQVFKKVQ
• Sequence Similarities: Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Gene Information

• Gene Name: RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
• Official Symbol: RBP1
• Synonyms: RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC
• Gene ID: 5947
• mRNA Refseq: NM_001130992
• Protein Refseq: NP_001124464
• MIM: 180260
• Uniprot ID: P09455
• Chromosome Location: 3q21-q23
• Pathway: Retinoic acid receptors-mediated signaling, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem
• Function: lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity