Recombinant Human RBP1 protein, GST-tagged
Cat.No. : | RBP1-30186H |
Product Overview : | Recombinant Human RBP1 (1-135 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gln135 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RBP1 retinol binding protein 1, cellular [ Homo sapiens ] |
Official Symbol | RBP1 |
Synonyms | RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC; CRBP-I; cellular retinol-binding protein I; retinol-binding protein 1, cellular; CRABP-I; |
Gene ID | 5947 |
mRNA Refseq | NM_001130992 |
Protein Refseq | NP_001124464 |
MIM | 180260 |
UniProt ID | P09455 |
◆ Recombinant Proteins | ||
RBP1-1864H | Recombinant Human RBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBP1-12152Z | Recombinant Zebrafish RBP1 | +Inquiry |
Rbp1-598R | Recombinant Rat Rbp1 Protein, His-tagged | +Inquiry |
RBP1-597P | Recombinant Pig RBP1 Protein, His-tagged | +Inquiry |
RBP1-4746H | Recombinant Human Retinol Binding Protein 1, Cellular, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP1-2457HCL | Recombinant Human RBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP1 Products
Required fields are marked with *
My Review for All RBP1 Products
Required fields are marked with *