Recombinant Human RBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RBP7-4968H |
Product Overview : | RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. |
Molecular Mass : | 15.5 kDa |
AA Sequence : | MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RBP7 retinol binding protein 7 [ Homo sapiens (human) ] |
Official Symbol | RBP7 |
Synonyms | RBP7; retinol binding protein 7, cellular; retinoid-binding protein 7; CRBPIV; CRABP4; CRABP-IV; retinoid binding protein 7; cellular retinoic acid-binding protein 4; cellular retinoic acid-binding protein IV; putative cellular retinol-binding protein CRBP IV; CRBP4; MGC70641; |
Gene ID | 116362 |
mRNA Refseq | NM_052960 |
Protein Refseq | NP_443192 |
MIM | 608604 |
UniProt ID | Q96R05 |
◆ Recombinant Proteins | ||
RBP7-31300TH | Recombinant Human RBP7, His-tagged | +Inquiry |
RBP7-1428P | Recombinant Pig RBP7 protein, His-tagged | +Inquiry |
RBP7-4968H | Recombinant Human RBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RBP7-2224H | Recombinant Human RBP7, GST-tagged | +Inquiry |
RBP7-382H | Recombinant Human RBP7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP7-2455HCL | Recombinant Human RBP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP7 Products
Required fields are marked with *
My Review for All RBP7 Products
Required fields are marked with *