Recombinant Human RCN3 protein, His-tagged
| Cat.No. : | RCN3-3142H |
| Product Overview : | Recombinant Human RCN3 protein(71 - 161 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 71 - 161 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RCN3 reticulocalbin 3, EF-hand calcium binding domain [ Homo sapiens ] |
| Official Symbol | RCN3 |
| Synonyms | RCN3; reticulocalbin 3, EF-hand calcium binding domain; reticulocalbin-3; RLP49; reticulocabin; EF-hand calcium-binding protein RLP49; |
| Gene ID | 57333 |
| mRNA Refseq | NM_020650 |
| Protein Refseq | NP_065701 |
| UniProt ID | Q96D15 |
| ◆ Recombinant Proteins | ||
| RCN3-301362H | Recombinant Human RCN3 protein, GST-tagged | +Inquiry |
| RCN3-3142H | Recombinant Human RCN3 protein, His-tagged | +Inquiry |
| RCN3-8592H | Recombinant Human RCN3 protein(Met1-His324), His-tagged | +Inquiry |
| RCN3-5548H | Recombinant Human Reticulocalbin 3, EF-Hand Calcium Binding Domain, His-tagged | +Inquiry |
| RCN3-6064H | Recombinant Human RCN3 Protein (Lys21-Leu328), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RCN3-1282HCL | Recombinant Human RCN3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RCN3 Products
Required fields are marked with *
My Review for All RCN3 Products
Required fields are marked with *
