Recombinant Human RDH11 Protein (22-318 aa), His-SUMO-tagged

Cat.No. : RDH11-769H
Product Overview : Recombinant Human RDH11 Protein (22-318 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 22-318 aa
Description : Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 49.0 kDa
AA Sequence : PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name RDH11 retinol dehydrogenase 11 (all-trans/9-cis/11-cis) [ Homo sapiens ]
Official Symbol RDH11
Synonyms RDH11; ARSDR1; MDT1; SDR7C1; CGI82; PSDR1; RALR1; SCALD; HCBP12; FLJ32633;
Gene ID 51109
mRNA Refseq NM_001252650
Protein Refseq NP_001239579
MIM 607849
UniProt ID Q8TC12

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RDH11 Products

Required fields are marked with *

My Review for All RDH11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon