Recombinant Human RDH11 Protein (22-318 aa), His-SUMO-tagged
| Cat.No. : | RDH11-769H |
| Product Overview : | Recombinant Human RDH11 Protein (22-318 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 22-318 aa |
| Description : | Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 49.0 kDa |
| AA Sequence : | PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | RDH11 retinol dehydrogenase 11 (all-trans/9-cis/11-cis) [ Homo sapiens ] |
| Official Symbol | RDH11 |
| Synonyms | RDH11; ARSDR1; MDT1; SDR7C1; CGI82; PSDR1; RALR1; SCALD; HCBP12; FLJ32633; |
| Gene ID | 51109 |
| mRNA Refseq | NM_001252650 |
| Protein Refseq | NP_001239579 |
| MIM | 607849 |
| UniProt ID | Q8TC12 |
| ◆ Recombinant Proteins | ||
| RDH11-3654R | Recombinant Rhesus Macaque RDH11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RDH11-14046M | Recombinant Mouse RDH11 Protein | +Inquiry |
| Rdh11-5444M | Recombinant Mouse Rdh11 Protein, Myc/DDK-tagged | +Inquiry |
| RDH11-081H | Recombinant Human RDH11 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RDH11-769H | Recombinant Human RDH11 Protein (22-318 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RDH11-2438HCL | Recombinant Human RDH11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RDH11 Products
Required fields are marked with *
My Review for All RDH11 Products
Required fields are marked with *
