Recombinant Human RDH11 Protein (22-318 aa), His-SUMO-tagged

• Cat.No.: RDH11-769H
• Product Overview: Recombinant Human RDH11 Protein (22-318 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 22-318 aa
• Description: Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 49.0 kDa
• AA Sequence: PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: RDH11 retinol dehydrogenase 11 (all-trans/9-cis/11-cis) [ Homo sapiens ]
• Official Symbol: RDH11
• Synonyms: RDH11; ARSDR1; MDT1; SDR7C1; CGI82; PSDR1; RALR1; SCALD; HCBP12; FLJ32633
• Gene ID: 51109
• mRNA Refseq: NM_001252650
• Protein Refseq: NP_001239579
• MIM: 607849
• UniProt ID: Q8TC12