Recombinant Human RDH11 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | RDH11-081H |
Product Overview : | RDH11 MS Standard C13 and N15-labeled recombinant protein (NP_057110) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLSIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RDH11 retinol dehydrogenase 11 [ Homo sapiens (human) ] |
Official Symbol | RDH11 |
Synonyms | RDH11; retinol dehydrogenase 11; ARSDR1; CGI82; HCBP12; MDT1; PSDR1; RALR1; RDJCSS; SCALD; SDR7C1; retinol dehydrogenase 11; HCV core-binding protein HCBP12; androgen-regulated short-chain dehydrogenase/reductase 1; prostate short-chain dehydrogenase reductase 1; retinal reductase 1; retinol dehydrogenase 11 (all-trans/9-cis/11-cis); short chain dehydrogenase/reductase family 7C, member 1; EC 1.1.1.300 |
Gene ID | 51109 |
mRNA Refseq | NM_016026 |
Protein Refseq | NP_057110 |
MIM | 607849 |
UniProt ID | Q8TC12 |
◆ Recombinant Proteins | ||
RDH11-769H | Recombinant Human RDH11 Protein (22-318 aa), His-SUMO-tagged | +Inquiry |
RDH11-595C | Recombinant Cynomolgus Monkey RDH11 Protein, His (Fc)-Avi-tagged | +Inquiry |
RDH11-081H | Recombinant Human RDH11 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RDH11-3654R | Recombinant Rhesus Macaque RDH11 Protein, His (Fc)-Avi-tagged | +Inquiry |
RDH11-7507M | Recombinant Mouse RDH11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDH11-2438HCL | Recombinant Human RDH11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RDH11 Products
Required fields are marked with *
My Review for All RDH11 Products
Required fields are marked with *
0
Inquiry Basket