Recombinant Human RDH11 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : RDH11-081H
Product Overview : RDH11 MS Standard C13 and N15-labeled recombinant protein (NP_057110) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is an NADPH-dependent retinal reductase and a short-chain dehydrogenase/reductase. The encoded protein has no steroid dehydrogenase activity.
Molecular Mass : 35.4 kDa
AA Sequence : MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLSIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RDH11 retinol dehydrogenase 11 [ Homo sapiens (human) ]
Official Symbol RDH11
Synonyms RDH11; retinol dehydrogenase 11; ARSDR1; CGI82; HCBP12; MDT1; PSDR1; RALR1; RDJCSS; SCALD; SDR7C1; retinol dehydrogenase 11; HCV core-binding protein HCBP12; androgen-regulated short-chain dehydrogenase/reductase 1; prostate short-chain dehydrogenase reductase 1; retinal reductase 1; retinol dehydrogenase 11 (all-trans/9-cis/11-cis); short chain dehydrogenase/reductase family 7C, member 1; EC 1.1.1.300
Gene ID 51109
mRNA Refseq NM_016026
Protein Refseq NP_057110
MIM 607849
UniProt ID Q8TC12

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RDH11 Products

Required fields are marked with *

My Review for All RDH11 Products

Required fields are marked with *

0
cart-icon
0
compare icon