Recombinant Human RDX protein, GST-tagged
Cat.No. : | RDX-2242H |
Product Overview : | Recombinant Human RDX protein(1-301 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-301 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIE |
Gene Name | RDX radixin [ Homo sapiens ] |
Official Symbol | RDX |
Synonyms | RDX; radixin; deafness, autosomal recessive 24 , DFNB24; DFNB24; |
Gene ID | 5962 |
mRNA Refseq | NM_002906 |
Protein Refseq | NP_002897 |
MIM | 179410 |
UniProt ID | P35241 |
◆ Recombinant Proteins | ||
RDX-6754H | Recombinant Human RDX protein, GST-tagged | +Inquiry |
RDX-1873H | Recombinant Human RDX Protein, His (Fc)-Avi-tagged | +Inquiry |
RDX-6794H | Recombinant Human RDX protein, His-tagged | +Inquiry |
RDX-429HF | Recombinant Full Length Human RDX Protein | +Inquiry |
Rdx-5445M | Recombinant Mouse Rdx Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDX-2433HCL | Recombinant Human RDX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RDX Products
Required fields are marked with *
My Review for All RDX Products
Required fields are marked with *
0
Inquiry Basket