Recombinant Human REEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : REEP1-5097H
Product Overview : REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
Molecular Mass : 22.3 kDa
AA Sequence : MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name REEP1 receptor accessory protein 1 [ Homo sapiens (human) ]
Official Symbol REEP1
Synonyms REEP1; receptor accessory protein 1; HMN5B; SPG31; Yip2a; C2orf23; receptor expression-enhancing protein 1; spastic paraplegia 31 protein
Gene ID 65055
mRNA Refseq NM_022912
Protein Refseq NP_075063
MIM 609139
UniProt ID Q9H902

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REEP1 Products

Required fields are marked with *

My Review for All REEP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon