Recombinant Human REEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: REEP1-5097H
• Product Overview: REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 22.3 kDa
• AA Sequence: MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: REEP1 receptor accessory protein 1 [ Homo sapiens (human) ]
• Official Symbol: REEP1
• Synonyms: REEP1; receptor accessory protein 1; HMN5B; SPG31; Yip2a; C2orf23; receptor expression-enhancing protein 1; spastic paraplegia 31 protein
• Gene ID: 65055
• mRNA Refseq: NM_022912
• Protein Refseq: NP_075063
• MIM: 609139
• UniProt ID: Q9H902