Recombinant Human REEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | REEP1-5097H |
| Product Overview : | REEP1 MS Standard C13 and N15-labeled recombinant protein (NP_075063) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 22.3 kDa |
| AA Sequence : | MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | REEP1 receptor accessory protein 1 [ Homo sapiens (human) ] |
| Official Symbol | REEP1 |
| Synonyms | REEP1; receptor accessory protein 1; HMN5B; SPG31; Yip2a; C2orf23; receptor expression-enhancing protein 1; spastic paraplegia 31 protein |
| Gene ID | 65055 |
| mRNA Refseq | NM_022912 |
| Protein Refseq | NP_075063 |
| MIM | 609139 |
| UniProt ID | Q9H902 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REEP1 Products
Required fields are marked with *
My Review for All REEP1 Products
Required fields are marked with *




