Recombinant Human REEP5 Protein, GST-Tagged

Cat.No. : REEP5-1327H
Product Overview : Human C5orf18 partial ORF (NP_005660, 113 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : REEP5 (Receptor Accessory Protein 5) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Olfactory Signaling Pathway. An important paralog of this gene is REEP6.
Molecular Mass : 33.66 kDa
AA Sequence : KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name REEP5 receptor accessory protein 5 [ Homo sapiens ]
Official Symbol REEP5
Synonyms REEP5; receptor accessory protein 5; C5orf18, chromosome 5 open reading frame 18; receptor expression-enhancing protein 5; D5S346; deleted in polyposis 1; DP1; polyposis coli region hypothetical protein DP1; polyposis locus protein 1; TB2; receptor expression enhancing protein 5; YOP1; C5orf18; MGC70440;
Gene ID 7905
mRNA Refseq NM_005669
Protein Refseq NP_005660
MIM 125265
UniProt ID Q00765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REEP5 Products

Required fields are marked with *

My Review for All REEP5 Products

Required fields are marked with *

0
cart-icon