Recombinant Human REEP5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : REEP5-631H
Product Overview : REEP5 MS Standard C13 and N15-labeled recombinant protein (NP_005660) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May promote functional cell surface expression of olfactory receptors.
Molecular Mass : 21.3 kDa
AA Sequence : MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKSTSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name REEP5 receptor accessory protein 5 [ Homo sapiens (human) ]
Official Symbol REEP5
Synonyms REEP5; receptor accessory protein 5; C5orf18, chromosome 5 open reading frame 18; receptor expression-enhancing protein 5; D5S346; deleted in polyposis 1; DP1; polyposis coli region hypothetical protein DP1; polyposis locus protein 1; TB2; receptor expression enhancing protein 5; YOP1; C5orf18; MGC70440;
Gene ID 7905
mRNA Refseq NM_005669
Protein Refseq NP_005660
MIM 125265
UniProt ID Q00765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REEP5 Products

Required fields are marked with *

My Review for All REEP5 Products

Required fields are marked with *

0
cart-icon
0
compare icon