Recombinant Human REEP6 protein, GST-tagged

Cat.No. : REEP6-301254H
Product Overview : Recombinant Human REEP6 (1-184 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Lys184
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name REEP6 receptor accessory protein 6 [ Homo sapiens ]
Official Symbol REEP6
Synonyms REEP6; receptor accessory protein 6; C19orf32, chromosome 19 open reading frame 32; receptor expression-enhancing protein 6; deleted in polyposis 1 like 1; DP1L1; FLJ25383; polyposis locus protein 1 like 1; deleted in polyposis 1-like 1; polyposis locus protein 1-like 1; receptor expression enhancing protein 6; TB2L1; C19orf32;
Gene ID 92840
mRNA Refseq NM_138393
Protein Refseq NP_612402
MIM 609346
UniProt ID Q96HR9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REEP6 Products

Required fields are marked with *

My Review for All REEP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon