Recombinant Human REEP6 protein, GST-tagged
Cat.No. : | REEP6-301254H |
Product Overview : | Recombinant Human REEP6 (1-184 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Lys184 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | REEP6 receptor accessory protein 6 [ Homo sapiens ] |
Official Symbol | REEP6 |
Synonyms | REEP6; receptor accessory protein 6; C19orf32, chromosome 19 open reading frame 32; receptor expression-enhancing protein 6; deleted in polyposis 1 like 1; DP1L1; FLJ25383; polyposis locus protein 1 like 1; deleted in polyposis 1-like 1; polyposis locus protein 1-like 1; receptor expression enhancing protein 6; TB2L1; C19orf32; |
Gene ID | 92840 |
mRNA Refseq | NM_138393 |
Protein Refseq | NP_612402 |
MIM | 609346 |
UniProt ID | Q96HR9 |
◆ Cell & Tissue Lysates | ||
REEP6-2425HCL | Recombinant Human REEP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REEP6 Products
Required fields are marked with *
My Review for All REEP6 Products
Required fields are marked with *