Recombinant Human REEP6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: REEP6-4435H
• Product Overview: REEP6 MS Standard C13 and N15-labeled recombinant protein (NP_612402) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene may be involved in the transport of receptors from the endoplasmic reticulum (ER) to the cell surface. The encoded protein may also play a role in regulating ER membrane structure. This gene is required for the proper development of retinal rods and photoreceptors, with defects in this gene being associated with retinitis pigmentosa 77.
• Molecular Mass: 20.7 kDa
• AA Sequence: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: REEP6 receptor accessory protein 6 [ Homo sapiens (human) ]
• Official Symbol: REEP6
• Synonyms: REEP6; receptor accessory protein 6; C19orf32, chromosome 19 open reading frame 32; receptor expression-enhancing protein 6; deleted in polyposis 1 like 1; DP1L1; FLJ25383; polyposis locus protein 1 like 1; deleted in polyposis 1-like 1; polyposis locus protein 1-like 1; receptor expression enhancing protein 6; TB2L1; C19orf32
• Gene ID: 92840
• mRNA Refseq: NM_138393
• Protein Refseq: NP_612402
• MIM: 609346
• UniProt ID: Q96HR9