Recombinant Human REG1B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | REG1B-4180H |
Product Overview : | REG1B MS Standard C13 and N15-labeled recombinant protein (NP_006498) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV based on the primary structures of the encoded proteins. This gene encodes a protein secreted by the exocrine pancreas that is highly similar to the REG1A protein. The related REG1A protein is associated with islet cell regeneration and diabetogenesis, and may be involved in pancreatic lithogenesis. Reg family members REG1A, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. |
Molecular Mass : | 18.7 kDa |
AA Sequence : | MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | REG1B regenerating islet-derived 1 beta [ Homo sapiens (human) ] |
Official Symbol | REG1B |
Synonyms | REG1B; regenerating islet-derived 1 beta; regenerating islet derived 1 beta (pancreatic stone protein, pancreatic thread protein); lithostathine-1-beta; lithostathine 1 beta; PSPS2; REGH; REGI BETA; REGL; secretory pancreatic stone protein 2; PSP-2; REG-1-beta; pancreatic stone protein 2; regenerating protein I beta; regenerating islet-derived protein 1-beta; regenerating islet-derived 1 beta (pancreatic stone protein, pancreatic thread protein); REGI-BETA; |
Gene ID | 5968 |
mRNA Refseq | NM_006507 |
Protein Refseq | NP_006498 |
MIM | 167771 |
UniProt ID | P48304 |
◆ Recombinant Proteins | ||
REG1B-91C | Recombinant Cynomolgus REG1B, His tagged | +Inquiry |
REG1B-806H | Recombinant Human REG1B Protein, MYC/DDK-tagged | +Inquiry |
REG1B-0277H | Recombinant Human REG1B protein, His-tagged | +Inquiry |
REG1B-4180H | Recombinant Human REG1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
REG1B-3919H | Recombinant Human Regenerating Islet-Derived 1 Beta, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG1B-953CCL | Recombinant Cynomolgus REG1B cell lysate | +Inquiry |
REG1B-2449HCL | Recombinant Human REG1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All REG1B Products
Required fields are marked with *
My Review for All REG1B Products
Required fields are marked with *
0
Inquiry Basket