Recombinant Human REG1B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : REG1B-4180H
Product Overview : REG1B MS Standard C13 and N15-labeled recombinant protein (NP_006498) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV based on the primary structures of the encoded proteins. This gene encodes a protein secreted by the exocrine pancreas that is highly similar to the REG1A protein. The related REG1A protein is associated with islet cell regeneration and diabetogenesis, and may be involved in pancreatic lithogenesis. Reg family members REG1A, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication.
Molecular Mass : 18.7 kDa
AA Sequence : MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name REG1B regenerating islet-derived 1 beta [ Homo sapiens (human) ]
Official Symbol REG1B
Synonyms REG1B; regenerating islet-derived 1 beta; regenerating islet derived 1 beta (pancreatic stone protein, pancreatic thread protein); lithostathine-1-beta; lithostathine 1 beta; PSPS2; REGH; REGI BETA; REGL; secretory pancreatic stone protein 2; PSP-2; REG-1-beta; pancreatic stone protein 2; regenerating protein I beta; regenerating islet-derived protein 1-beta; regenerating islet-derived 1 beta (pancreatic stone protein, pancreatic thread protein); REGI-BETA;
Gene ID 5968
mRNA Refseq NM_006507
Protein Refseq NP_006498
MIM 167771
UniProt ID P48304

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REG1B Products

Required fields are marked with *

My Review for All REG1B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon