"REG3A" Related Products

Expand
Expand

Recombinant Human REG3A protein, T7/His-tagged

Cat.No.: REG3A-128H
Product Overview: Recombinant human REG3a cDNA (27 – 175 aa, derived from BC036776) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRP SGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCA SLSRSTAFLRWKDYNCNVRLPYVCKFTD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human REG3a mediated membrane phospholipids binding for regulating inflammation pathway in anti-bacterial or cancer cell proliferation study with this protein as either coating matrix protein or soluble factor.2. May be used for REG3a protein-protein interaction assay.3. Potential biomarker protein for monitoring cancer growth.4. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: REG3A regenerating islet-derived 3 alpha [ Homo sapiens ]
Official Symbol: REG3A
Synonyms: REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein , PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565;
Gene ID: 5068
mRNA Refseq: NM_002580
Protein Refseq: NP_002571
MIM: 167805
UniProt ID: Q06141
Chromosome Location: 2p12
Function: binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.