"REG3A" Related Products

Expand
Expand

Recombinant Human REG3A protein, T7/His-tagged

Cat.No.: REG3A-128H
Product Overview: Recombinant human REG3a cDNA (27 – 175 aa, derived from BC036776) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRP SGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCA SLSRSTAFLRWKDYNCNVRLPYVCKFTD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human REG3a mediated membrane phospholipids binding for regulating inflammation pathway in anti-bacterial or cancer cell proliferation study with this protein as either coating matrix protein or soluble factor.2. May be used for REG3a protein-protein interaction assay.3. Potential biomarker protein for monitoring cancer growth.4. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: REG3A regenerating islet-derived 3 alpha [ Homo sapiens ]
Official Symbol: REG3A
Synonyms: REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein , PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565;
Gene ID: 5068
mRNA Refseq: NM_002580
Protein Refseq: NP_002571
MIM: 167805
UniProt ID: Q06141
Chromosome Location: 2p12
Function: binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.