Recombinant Human REG3A protein, T7/His-tagged
Cat.No. : | REG3A-128H |
Product Overview : | Recombinant human REG3a cDNA (27 – 175 aa, derived from BC036776) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 27-175 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRP SGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCA SLSRSTAFLRWKDYNCNVRLPYVCKFTD |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human REG3a mediated membrane phospholipids binding for regulating inflammation pathway in anti-bacterial or cancer cell proliferation study with this protein as either coating matrix protein or soluble factor.2. May be used for REG3a protein-protein interaction assay.3. Potential biomarker protein for monitoring cancer growth.4. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | REG3A regenerating islet-derived 3 alpha [ Homo sapiens ] |
Official Symbol | REG3A |
Synonyms | REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein , PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565; |
Gene ID | 5068 |
mRNA Refseq | NM_002580 |
Protein Refseq | NP_002571 |
MIM | 167805 |
UniProt ID | Q06141 |
Chromosome Location | 2p12 |
Function | binding; sugar binding; |
◆ Recombinant Proteins | ||
REG3A-431H | Recombinant Human REG3A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
REG3A-3699H | Recombinant Human REG3A, His-tagged(Human) | +Inquiry |
Reg3a-2012M | Recombinant Mouse Reg3a Protein, His-tagged | +Inquiry |
REG3A-86H | Active Recombinant Human REG3A Protein | +Inquiry |
REG3A-2337H | Recombinant Full Length Human REG3A, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3A-1326RCL | Recombinant Rat REG3A cell lysate | +Inquiry |
REG3A-2691MCL | Recombinant Mouse REG3A cell lysate | +Inquiry |
REG3A-2496HCL | Recombinant Human REG3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REG3A Products
Required fields are marked with *
My Review for All REG3A Products
Required fields are marked with *