Recombinant Human REG3A protein, T7/His-tagged

Cat.No. : REG3A-128H
Product Overview : Recombinant human REG3a cDNA (27 – 175 aa, derived from BC036776) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 27-175 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRP SGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCA SLSRSTAFLRWKDYNCNVRLPYVCKFTD
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human REG3a mediated membrane phospholipids binding for regulating inflammation pathway in anti-bacterial or cancer cell proliferation study with this protein as either coating matrix protein or soluble factor.2. May be used for REG3a protein-protein interaction assay.3. Potential biomarker protein for monitoring cancer growth.4. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name REG3A regenerating islet-derived 3 alpha [ Homo sapiens ]
Official Symbol REG3A
Synonyms REG3A; regenerating islet-derived 3 alpha; pancreatitis associated protein , PAP; regenerating islet-derived protein 3-alpha; HIP; PAP1; PBCGF; REG III; REG3; REG-3-alpha; reg III-alpha; PAP homologous protein; human proislet peptide; pancreatitis-associated protein 1; proliferation-inducing protein 34; proliferation-inducing protein 42; hepatocarcinoma-intestine-pancreas; pancreatic beta cell growth factor; regenerating islet-derived protein III-alpha; PAP; PAP-H; REG-III; FLJ18565;
Gene ID 5068
mRNA Refseq NM_002580
Protein Refseq NP_002571
MIM 167805
UniProt ID Q06141
Chromosome Location 2p12
Function binding; sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REG3A Products

Required fields are marked with *

My Review for All REG3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon