Recombinant Human REG3G Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | REG3G-2705H |
Product Overview : | REG3G MS Standard C13 and N15-labeled recombinant protein (NP_940850) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobial lectin with activity against Gram-positive bacteria. Alternative splicing results in multiple transcript variants encoding multiple isoforms. |
Molecular Mass : | 19.3 kDa |
AA Sequence : | MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | REG3G regenerating islet-derived 3 gamma [ Homo sapiens (human) ] |
Official Symbol | REG3G |
Synonyms | REG3G; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; LPPM429; PAP1B; UNQ429; PAP-1B; REG-3-gamma; reg III-gamma; regenerating gene III; pancreatitis-associated protein 1B; pancreatitis-associated protein IB; regenerating islet-derived protein III-gamma; PAPIB; PAP IB; REG-III; MGC118998; MGC118999; MGC119001; |
Gene ID | 130120 |
mRNA Refseq | NM_198448 |
Protein Refseq | NP_940850 |
MIM | 609933 |
UniProt ID | Q6UW15 |
◆ Recombinant Proteins | ||
REG3G-1202H | Recombinant Human REG3G protein(27-175aa), GST-tagged | +Inquiry |
Reg3g-3420R | Recombinant Rat Reg3g protein, His-tagged | +Inquiry |
REG3G-4990R | Recombinant Rat REG3G Protein | +Inquiry |
REG3G-5633H | Recombinant Human REG3G Protein (Glu27-Asp175), C-His tagged | +Inquiry |
REG3G-4649R | Recombinant Rat REG3G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3G-2438HCL | Recombinant Human REG3G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All REG3G Products
Required fields are marked with *
My Review for All REG3G Products
Required fields are marked with *
0
Inquiry Basket