Recombinant Human REG4 Protein, His-tagged
| Cat.No. : | REG4-424H |
| Product Overview : | Recombinant human REG4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 158 |
| Description : | Enables heparin binding activity and mannan binding activity. Predicted to act upstream of or within response to bacterium. Located in cytoplasm. |
| Form : | Lyophilized |
| Molecular Mass : | 16.7 kDa |
| AA Sequence : | MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Gene Name | REG4 regenerating islet-derived family, member 4 [ Homo sapiens (human) ] |
| Official Symbol | REG4 |
| Synonyms | REG4; regenerating islet-derived family, member 4; regenerating islet-derived protein 4; gastrointestinal secretory protein; GISP; REG IV; regenerating gene type IV; RELP; REG-4; reg IV; REG-like protein; regenerating islet-derived protein IV; REG-IV; |
| Gene ID | 83998 |
| mRNA Refseq | NM_001159352 |
| Protein Refseq | NP_001152824 |
| MIM | 609846 |
| UniProt ID | Q9BYZ8 |
| ◆ Recombinant Proteins | ||
| REG4-4991R | Recombinant Rat REG4 Protein | +Inquiry |
| REG4-314H | Recombinant Human REG4, Fc tagged | +Inquiry |
| REG4-6624H | Recombinant Human REG4 Protein (Ser29-Thr140), N-His tagged | +Inquiry |
| REG4-697H | Recombinant Human REG4 Protein, His-tagged | +Inquiry |
| Reg4-8748R | Recombinant Rat Reg4 protein(Met1-Pro157), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| REG4-1328RCL | Recombinant Rat REG4 cell lysate | +Inquiry |
| REG4-001HCL | Recombinant Human REG4 cell lysate | +Inquiry |
| REG4-979HCL | Recombinant Human REG4 cell lysate | +Inquiry |
| REG4-2111MCL | Recombinant Mouse REG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REG4 Products
Required fields are marked with *
My Review for All REG4 Products
Required fields are marked with *



