Recombinant Human REM1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | REM1-4906H |
| Product Overview : | REM1 MS Standard C13 and N15-labeled recombinant protein (NP_054731) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells. |
| Molecular Mass : | 32.9 kDa |
| AA Sequence : | MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | REM1 RRAD and GEM like GTPase 1 [ Homo sapiens (human) ] |
| Official Symbol | REM1 |
| Synonyms | REM1; RAS (RAD and GEM)-like GTP-binding 1; RAS (RAD and GEM) like GTP binding, REM; GTP-binding protein REM 1; GES; GTPase GES; rad and Gem-like GTP-binding protein 1; GTPase-regulating endothelial cell sprouting; REM; GD:REM; MGC48669; |
| Gene ID | 28954 |
| mRNA Refseq | NM_014012 |
| Protein Refseq | NP_054731 |
| MIM | 610388 |
| UniProt ID | O75628 |
| ◆ Recombinant Proteins | ||
| REM1-11391Z | Recombinant Zebrafish REM1 | +Inquiry |
| REM1-4906H | Recombinant Human REM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Rem1-5460M | Recombinant Mouse Rem1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| REM1-1494HCL | Recombinant Human REM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REM1 Products
Required fields are marked with *
My Review for All REM1 Products
Required fields are marked with *
