Recombinant Human REM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : REM1-4906H
Product Overview : REM1 MS Standard C13 and N15-labeled recombinant protein (NP_054731) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.
Molecular Mass : 32.9 kDa
AA Sequence : MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name REM1 RRAD and GEM like GTPase 1 [ Homo sapiens (human) ]
Official Symbol REM1
Synonyms REM1; RAS (RAD and GEM)-like GTP-binding 1; RAS (RAD and GEM) like GTP binding, REM; GTP-binding protein REM 1; GES; GTPase GES; rad and Gem-like GTP-binding protein 1; GTPase-regulating endothelial cell sprouting; REM; GD:REM; MGC48669;
Gene ID 28954
mRNA Refseq NM_014012
Protein Refseq NP_054731
MIM 610388
UniProt ID O75628

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REM1 Products

Required fields are marked with *

My Review for All REM1 Products

Required fields are marked with *

0
cart-icon