Recombinant Human RENBP
Cat.No. : | RENBP-30477TH |
Product Overview : | Recombinant fragment corresponding to amino acids 311-410 of Human RENBP with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze the interconversion of N-acetylglucosamine to N-acetylmannosamine, indicating that it is a GlcNAc 2-epimerase. Transcript variants utilizing alternative promoters have been described in the literature. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR |
Sequence Similarities : | Belongs to the N-acylglucosamine 2-epimerase family. |
Gene Name | RENBP renin binding protein [ Homo sapiens ] |
Official Symbol | RENBP |
Synonyms | RENBP; renin binding protein; N-acylglucosamine 2-epimerase; GlcNAc 2 epimerase; N acetyl D glucosamine 2 epimerase; N acylglucosamine 2 epimerase; RBP; RNBP; |
Gene ID | 5973 |
mRNA Refseq | NM_002910 |
Protein Refseq | NP_002901 |
MIM | 312420 |
Uniprot ID | P51606 |
Chromosome Location | X |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; |
Function | ATP binding; N-acylglucosamine 2-epimerase activity; endopeptidase inhibitor activity; enzyme inhibitor activity; isomerase activity; |
◆ Recombinant Proteins | ||
RENBP-30477TH | Recombinant Human RENBP | +Inquiry |
RENBP-4654R | Recombinant Rat RENBP Protein, His (Fc)-Avi-tagged | +Inquiry |
RENBP-6171H | Recombinant Human RENBP Protein (Met11-Gln254), N-His tagged | +Inquiry |
RENBP-7524M | Recombinant Mouse RENBP Protein, His (Fc)-Avi-tagged | +Inquiry |
RENBP-8050H | Recombinant Human RENBP protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RENBP-537HCL | Recombinant Human RENBP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RENBP Products
Required fields are marked with *
My Review for All RENBP Products
Required fields are marked with *