Recombinant Human RENBP

Cat.No. : RENBP-30477TH
Product Overview : Recombinant fragment corresponding to amino acids 311-410 of Human RENBP with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze the interconversion of N-acetylglucosamine to N-acetylmannosamine, indicating that it is a GlcNAc 2-epimerase. Transcript variants utilizing alternative promoters have been described in the literature.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR
Sequence Similarities : Belongs to the N-acylglucosamine 2-epimerase family.
Gene Name RENBP renin binding protein [ Homo sapiens ]
Official Symbol RENBP
Synonyms RENBP; renin binding protein; N-acylglucosamine 2-epimerase; GlcNAc 2 epimerase; N acetyl D glucosamine 2 epimerase; N acylglucosamine 2 epimerase; RBP; RNBP;
Gene ID 5973
mRNA Refseq NM_002910
Protein Refseq NP_002901
MIM 312420
Uniprot ID P51606
Chromosome Location X
Pathway Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem;
Function ATP binding; N-acylglucosamine 2-epimerase activity; endopeptidase inhibitor activity; enzyme inhibitor activity; isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RENBP Products

Required fields are marked with *

My Review for All RENBP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon