Recombinant Human RENBP

• Cat.No.: RENBP-30477TH
• Product Overview: Recombinant fragment corresponding to amino acids 311-410 of Human RENBP with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze the interconversion of N-acetylglucosamine to N-acetylmannosamine, indicating that it is a GlcNAc 2-epimerase. Transcript variants utilizing alternative promoters have been described in the literature.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR
• Sequence Similarities: Belongs to the N-acylglucosamine 2-epimerase family.

Gene Information

• Gene Name: RENBP renin binding protein [ Homo sapiens ]
• Official Symbol: RENBP
• Synonyms: RENBP; renin binding protein; N-acylglucosamine 2-epimerase; GlcNAc 2 epimerase; N acetyl D glucosamine 2 epimerase; N acylglucosamine 2 epimerase; RBP; RNBP
• Gene ID: 5973
• mRNA Refseq: NM_002910
• Protein Refseq: NP_002901
• MIM: 312420
• Uniprot ID: P51606
• Chromosome Location: X
• Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem
• Function: ATP binding; N-acylglucosamine 2-epimerase activity; endopeptidase inhibitor activity; enzyme inhibitor activity; isomerase activity