Recombinant Human RENBP
| Cat.No. : | RENBP-30477TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 311-410 of Human RENBP with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze the interconversion of N-acetylglucosamine to N-acetylmannosamine, indicating that it is a GlcNAc 2-epimerase. Transcript variants utilizing alternative promoters have been described in the literature. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSR |
| Sequence Similarities : | Belongs to the N-acylglucosamine 2-epimerase family. |
| Gene Name | RENBP renin binding protein [ Homo sapiens ] |
| Official Symbol | RENBP |
| Synonyms | RENBP; renin binding protein; N-acylglucosamine 2-epimerase; GlcNAc 2 epimerase; N acetyl D glucosamine 2 epimerase; N acylglucosamine 2 epimerase; RBP; RNBP; |
| Gene ID | 5973 |
| mRNA Refseq | NM_002910 |
| Protein Refseq | NP_002901 |
| MIM | 312420 |
| Uniprot ID | P51606 |
| Chromosome Location | X |
| Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; |
| Function | ATP binding; N-acylglucosamine 2-epimerase activity; endopeptidase inhibitor activity; enzyme inhibitor activity; isomerase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RENBP Products
Required fields are marked with *
My Review for All RENBP Products
Required fields are marked with *




