Recombinant Human RER1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RER1-1220H |
Product Overview : | RER1 MS Standard C13 and N15-labeled recombinant protein (NP_008964) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a multi-pass membrane protein that is localized to the golgi apparatus. It is involved in the retention of endoplasmic reticulum (ER) membrane proteins in the ER and retrieval of ER membrane proteins from the early Golgi compartment to facilitate gamma-secretase complex assembly. |
Molecular Mass : | 23 kDa |
AA Sequence : | MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RER1 retention in endoplasmic reticulum sorting receptor 1 [ Homo sapiens (human) ] |
Official Symbol | RER1 |
Synonyms | RER1; retention in endoplasmic reticulum sorting receptor 1; protein RER1; RER1 retention in endoplasmic reticulum 1 homolog |
Gene ID | 11079 |
mRNA Refseq | NM_007033 |
Protein Refseq | NP_008964 |
UniProt ID | O15258 |
◆ Recombinant Proteins | ||
RER1-4656R | Recombinant Rat RER1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rer1-5464M | Recombinant Mouse Rer1 Protein, Myc/DDK-tagged | +Inquiry |
RER1-3667R | Recombinant Rhesus Macaque RER1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2941BF | Recombinant Full Length Bovine Protein Rer1(Rer1) Protein, His-Tagged | +Inquiry |
RFL24098GF | Recombinant Full Length Chicken Protein Rer1(Rer1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RER1-2419HCL | Recombinant Human RER1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RER1 Products
Required fields are marked with *
My Review for All RER1 Products
Required fields are marked with *