Recombinant Human RER1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RER1-1220H
Product Overview : RER1 MS Standard C13 and N15-labeled recombinant protein (NP_008964) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a multi-pass membrane protein that is localized to the golgi apparatus. It is involved in the retention of endoplasmic reticulum (ER) membrane proteins in the ER and retrieval of ER membrane proteins from the early Golgi compartment to facilitate gamma-secretase complex assembly.
Molecular Mass : 23 kDa
AA Sequence : MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RER1 retention in endoplasmic reticulum sorting receptor 1 [ Homo sapiens (human) ]
Official Symbol RER1
Synonyms RER1; retention in endoplasmic reticulum sorting receptor 1; protein RER1; RER1 retention in endoplasmic reticulum 1 homolog
Gene ID 11079
mRNA Refseq NM_007033
Protein Refseq NP_008964
UniProt ID O15258

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RER1 Products

Required fields are marked with *

My Review for All RER1 Products

Required fields are marked with *

0
cart-icon