Recombinant Human RETNLB Protein (24-111 aa), His-tagged

Cat.No. : RETNLB-2092H
Product Overview : Recombinant Human RETNLB Protein (24-111 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 24-111 aa
Description : Probable hormone.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 11.4 kDa
AA Sequence : QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name RETNLB resistin like beta [ Homo sapiens ]
Official Symbol RETNLB
Synonyms RETNLB; FIZZ2; HXCP2; RELMb; XCP2; FIZZ1; RELMbeta; RELM-beta;
Gene ID 84666
mRNA Refseq NM_032579
Protein Refseq NP_115968
MIM 605645
UniProt ID Q9BQ08

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RETNLB Products

Required fields are marked with *

My Review for All RETNLB Products

Required fields are marked with *

0
cart-icon
0
compare icon