Recombinant Human RETNLB Protein (24-111 aa), His-tagged

• Cat.No.: RETNLB-2092H
• Product Overview: Recombinant Human RETNLB Protein (24-111 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 24-111 aa
• Description: Probable hormone.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 11.4 kDa
• AA Sequence: QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: RETNLB resistin like beta [ Homo sapiens ]
• Official Symbol: RETNLB
• Synonyms: RETNLB; FIZZ2; HXCP2; RELMb; XCP2; FIZZ1; RELMbeta; RELM-beta
• Gene ID: 84666
• mRNA Refseq: NM_032579
• Protein Refseq: NP_115968
• MIM: 605645
• UniProt ID: Q9BQ08