Recombinant Human RETNLB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RETNLB-5569H |
| Product Overview : | RETNLB MS Standard C13 and N15-labeled recombinant protein (NP_115968) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Probable hormone. |
| Molecular Mass : | 11.7 kDa |
| AA Sequence : | MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RETNLB resistin like beta [ Homo sapiens (human) ] |
| Official Symbol | RETNLB |
| Synonyms | RETNLB; resistin like beta; resistin-like beta; FIZZ2; HXCP2; RELMb; found in inflammatory zone 1; colon carcinoma-related gene protein; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted A12-alpha-like protein 1; cysteine-rich secreted protein A12-alpha-like 1; colon and small intestine-specific cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 2; XCP2; FIZZ1; RELMbeta; RELM-beta; |
| Gene ID | 84666 |
| mRNA Refseq | NM_032579 |
| Protein Refseq | NP_115968 |
| MIM | 605645 |
| UniProt ID | Q9BQ08 |
| ◆ Recombinant Proteins | ||
| RETNLB-123H | Recombinant Human resistin like beta, His-tagged | +Inquiry |
| Retnlb-428M | Recombinant Mouse Resistin Like Beta, FLAG-tagged | +Inquiry |
| RETNLB-5569H | Recombinant Human RETNLB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RETNLB-29592TM | Recombinant Mouse Retnlb | +Inquiry |
| RETNLB-5004H | Recombinant Human Resistin Like Beta | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RETNLB-2416HCL | Recombinant Human RETNLB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RETNLB Products
Required fields are marked with *
My Review for All RETNLB Products
Required fields are marked with *
