Recombinant Human RFC1 Protein (402-492 aa), His-Myc-tagged
Cat.No. : | RFC1-2319H |
Product Overview : | Recombinant Human RFC1 Protein (402-492 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 402-492 aa |
Description : | The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.8 kDa |
AA Sequence : | GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RFC1 replication factor C (activator 1) 1, 145kDa [ Homo sapiens ] |
Official Symbol | RFC1 |
Synonyms | RFC1; A1; MHCBFB; PO GA; RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC; PO-GA; RECC1; MGC51786; |
Gene ID | 5981 |
mRNA Refseq | NM_001204747 |
Protein Refseq | NP_001191676 |
MIM | 102579 |
UniProt ID | P35251 |
◆ Recombinant Proteins | ||
RFC1-2394H | Recombinant Human RFC1 Protein (402-492 aa), His-tagged | +Inquiry |
RFC1-2319H | Recombinant Human RFC1 Protein (402-492 aa), His-Myc-tagged | +Inquiry |
RFC1-5591Z | Recombinant Zebrafish RFC1 | +Inquiry |
RFC1-01H | Recombinant Human RFC1 Protein, GST-tagged | +Inquiry |
RFC1-001H | Recombinant Human RFC1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFC1 Products
Required fields are marked with *
My Review for All RFC1 Products
Required fields are marked with *
0
Inquiry Basket