| Species : | Human | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | His&Myc | 
                                
                                    | Protein Length : | 402-492 aa | 
                                
                                    | Description : | The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair. | 
                                
                                    | Form : | Tris-based buffer,50% glycerol | 
                                
                                    | Molecular Mass : | 14.8 kDa | 
                                
                                    | AA Sequence : | GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA | 
                                
                                    | Purity : | > 85% as determined by SDS-PAGE. | 
                                
                                    | Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. | 
                                
                                    | Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
                                
                                    | Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |