Recombinant Human RFC1 Protein (402-492 aa), His-tagged
| Cat.No. : | RFC1-2394H |
| Product Overview : | Recombinant Human RFC1 Protein (402-492 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 402-492 aa |
| Description : | The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 11.8 kDa |
| AA Sequence : | GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | RFC1 replication factor C (activator 1) 1, 145kDa [ Homo sapiens ] |
| Official Symbol | RFC1 |
| Synonyms | RFC1; A1; MHCBFB; PO GA; RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; activator 1 subunit 1; RFC; PO-GA; RECC1; MGC51786; |
| Gene ID | 5981 |
| mRNA Refseq | NM_001204747 |
| Protein Refseq | NP_001191676 |
| MIM | 102579 |
| UniProt ID | P35251 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFC1 Products
Required fields are marked with *
My Review for All RFC1 Products
Required fields are marked with *
Recently Viewed
