Recombinant Human RFC1 Protein, His-tagged

• Cat.No.: RFC1-001H
• Product Overview: Recombinant Human RFC1 Protein, His-tagged, expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 800-1093 aa
• Tag: His
• Molecular Mass: 34 kDa
• AA Sequence: MNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRAKKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1mg/ml by BCA
• Storage Buffer: Sterile from PBS, pH7.4, 8% Trehalose, 10% Glycerol

Gene Information

• Gene Name: RFC1 replication factor C subunit 1 [ Homo sapiens (human) ]
• Official Symbol: RFC1
• Synonyms: RFC1; A1; MHCBFB; PO GA; RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC; PO-GA; RECC1; MGC51786
• Gene ID: 5981
• MIM: 102579
• UniProt ID: P35251