Recombinant Human RFC1 Protein, His-tagged
| Cat.No. : | RFC1-001H |
| Product Overview : | Recombinant Human RFC1 Protein, His-tagged, expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 800-1093 aa |
| Tag : | His |
| Molecular Mass : | 34 kDa |
| AA Sequence : | MNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRAKKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile from PBS, pH7.4, 8% Trehalose, 10% Glycerol |
| Gene Name | RFC1 replication factor C subunit 1 [ Homo sapiens (human) ] |
| Official Symbol | RFC1 |
| Synonyms | RFC1; A1; MHCBFB; PO GA; RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC; PO-GA; RECC1; MGC51786 |
| Gene ID | 5981 |
| MIM | 102579 |
| UniProt ID | P35251 |
| ◆ Recombinant Proteins | ||
| RFC1-5591Z | Recombinant Zebrafish RFC1 | +Inquiry |
| RFC1-001H | Recombinant Human RFC1 Protein, His-tagged | +Inquiry |
| RFC1-2319H | Recombinant Human RFC1 Protein (402-492 aa), His-Myc-tagged | +Inquiry |
| RFC1-1595C | Recombinant Chicken RFC1 | +Inquiry |
| RFC1-01H | Recombinant Human RFC1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RFC1 Products
Required fields are marked with *
My Review for All RFC1 Products
Required fields are marked with *
