Recombinant Human RFC4 protein, GST-tagged
Cat.No. : | RFC4-301109H |
Product Overview : | Recombinant Human RFC4 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Cys363 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RFC4 replication factor C (activator 1) 4, 37kDa [ Homo sapiens ] |
Official Symbol | RFC4 |
Synonyms | RFC4; replication factor C (activator 1) 4, 37kDa; replication factor C (activator 1) 4 (37kD); replication factor C subunit 4; A1; A1 37 kDa subunit; activator 1 37 kDa subunit; RFC 37 kDa subunit; RFC37; RF-C 37 kDa subunit; activator 1 subunit 4; replication factor C 37 kDa subunit; MGC27291; |
Gene ID | 5984 |
mRNA Refseq | NM_002916 |
Protein Refseq | NP_002907 |
MIM | 102577 |
UniProt ID | P35249 |
◆ Recombinant Proteins | ||
RFC4-3675R | Recombinant Rhesus Macaque RFC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFC4-01H | Recombinant Human RFC4 Protein, Myc/DDK-tagged | +Inquiry |
RFC4-3858R | Recombinant Rhesus monkey RFC4 Protein, His-tagged | +Inquiry |
RFC4-7539M | Recombinant Mouse RFC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFC4-14098M | Recombinant Mouse RFC4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFC4-2410HCL | Recombinant Human RFC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RFC4 Products
Required fields are marked with *
My Review for All RFC4 Products
Required fields are marked with *
0
Inquiry Basket